Recombinant Escherichia coli Inner membrane protein ynbA (ynbA)

Shipped with Ice Packs
In Stock

Description

Production and Expression

Recombinant ynbA is typically produced using plasmid-based systems in E. coli. Key insights into its expression include:

  • Vector Design: Medium-copy plasmids (e.g., p15A origin) often yield higher soluble protein than high-copy systems, reducing metabolic burden .

  • Promoter Systems: Inducible promoters like Plac or PT7 are commonly used, though weaker promoters may improve solubility .

  • Challenges: Overexpression can lead to inclusion body formation, requiring optimization of induction conditions and chaperone co-expression .

Functional Insights

While ynbA’s exact role is not fully resolved, current data suggest:

Predicted Functions

  • Membrane Localization: Annotated as an inner membrane protein with transmembrane domains .

  • Enzymatic Activity: Homology suggests potential roles in lipid metabolism, such as phosphatidylglycerophosphate synthase activity .

  • Regulation: Transcriptionally activated by the BglJ–RcsB heteromeric activator under stress conditions .

Research Applications

Recombinant ynbA is primarily used in:

  1. Membrane Protein Studies: As a model for probing inner membrane protein folding and stability .

  2. Enzyme Characterization: Screening for phosphotransferase or lipid-modifying activities .

  3. Transcriptional Regulation: Investigating BglJ–RcsB-dependent gene networks .

Knowledge Gaps and Future Directions

  • Functional Validation: No direct enzymatic assays or knockout studies confirming ynbA’s metabolic role in E. coli are documented in the reviewed literature.

  • Structural Data: Atomic-resolution structures or interaction networks remain uncharacterized.

  • Biotechnological Potential: Applications in synthetic biology (e.g., membrane engineering) are unexplored.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that we currently have in stock. However, if you have specific format requirements, kindly indicate them in your order remarks, and we will prepare the product according to your specifications.
Lead Time
Delivery times may vary depending on the purchase method and location. We recommend consulting your local distributor for specific delivery details.
Important: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C, while lyophilized protein can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during the production process. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ynbA; b1408; JW1405; Inner membrane protein YnbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ynbA
Target Protein Sequence
MTLYQIKPLFQSLLRPTMFWLYKHHVTANHITLAALALSLLTGLLLMLAAQPILFLLLPI VLFIRMALNALDGMLARECNQQTRLGAILNETGDVISDIALYLPFLFLPESNASLVILML FCTILTEFCGLLAQTINGVRSYAGPFGKSDRALIFGLWGLAVAIYPQWMQWNNLLWSIAS ILLLWTAINRCRSVLLMSAEI
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YnbA and what are its basic structural features?

YnbA is an inner membrane protein found in Escherichia coli K-12 (strain MG1655) with five predicted transmembrane domains. The protein contains 201 amino acids encoded by a 606 bp gene and features a C-terminus located in the cytoplasm . YnbA belongs to the CDP-alcohol phosphatidyltransferase domain-containing protein family, suggesting its involvement in phospholipid biosynthesis pathways. The protein is mapped to position [1,477,621 -> 1,478,226] (31.83 centisomes, 115°) in the E. coli genome .

How does YnbA compare to other inner membrane proteins in E. coli?

YnbA belongs to the diverse group of inner membrane proteins in E. coli that collectively maintain cellular homeostasis. Unlike well-characterized two-component systems such as BasS/BasR that regulate responses to environmental stimuli , YnbA's specific regulatory networks remain less defined. Similar to YbfA (another membrane-associated protein), YnbA may have roles in modulating cellular responses to external agents, though through different pathways than the DUF2517 domain-containing YbfA protein mentioned in the literature .

What are the optimal conditions for recombinant expression of YnbA in E. coli?

For effective recombinant expression of YnbA, researchers should consider the following methodology:

  • Optimize translation initiation site accessibility, as this factor significantly impacts successful expression of recombinant proteins in E. coli .

  • Consider codon optimization, particularly for the first nine codons, which has been shown to significantly affect expression levels of membrane proteins .

  • Use specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)).

  • Employ lower induction temperatures (16-25°C) to reduce protein aggregation and improve proper membrane insertion.

  • Test multiple promoter systems, with IPTG-inducible pET series vectors often providing good control over expression levels.

Research indicates that approximately 50% of recombinant proteins fail to express properly in host cells , making optimization particularly crucial for challenging membrane proteins like YnbA.

How can mRNA structure modification improve YnbA expression?

Based on current research on recombinant protein expression in E. coli, optimizing mRNA structure near the translation initiation site can dramatically improve expression outcomes. The accessibility of translation initiation sites modeled using mRNA base-unpairing across the Boltzmann's ensemble has been shown to be a critical factor in expression success . For YnbA specifically, researchers should:

  • Analyze the mRNA secondary structure near the Shine-Dalgarno sequence and start codon.

  • Use computational tools like TIsigner to redesign the first nine codons through synonymous substitutions that improve ribosome binding site accessibility .

  • Maintain the amino acid sequence while altering the nucleotide sequence to reduce strong secondary structures that inhibit translation initiation.

This approach has been validated across large datasets of over 11,430 recombinant proteins from 189 diverse species expressed in E. coli , making it a robust method for improving YnbA expression yields.

What purification strategies are most effective for recombinant YnbA?

Purifying membrane proteins like YnbA requires specialized approaches:

  • Membrane Extraction Protocol:

    • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

    • Resuspend in buffer containing 50 mM Tris-HCl (pH 8.0), 100 mM NaCl

    • Disrupt cells via sonication or pressure-based methods

    • Remove cell debris by centrifugation (10,000 × g, 20 min, 4°C)

    • Ultracentrifuge supernatant (100,000 × g, 1 hour, 4°C) to isolate membrane fraction

  • Solubilization and Purification:

    • Solubilize membrane fraction in buffer containing appropriate detergents (test n-dodecyl-β-D-maltoside, digitonin, or CHAPS)

    • Purify using Ni-NTA chromatography (for His-tagged constructs)

    • Consider size exclusion chromatography as a polishing step

    • Validate protein integrity using Western blotting with antibodies against the target or tag

Researchers should note that maintaining protein stability during purification is critical and may require screening multiple detergents or amphipathic agents.

What methods are most suitable for studying YnbA's role in membrane biology?

To comprehensively analyze YnbA's function in membrane biology, researchers should employ a multi-faceted approach:

  • Gene Knockout Studies:

    • Generate YnbA-deficient strains using lambda Red recombination methods similar to those used for YbfA

    • Compare growth rates, membrane integrity, and stress responses between wild-type and knockout strains

    • Complement the knockout with wild-type YnbA to confirm phenotype specificity

  • Localization Studies:

    • Employ GFP-fusion constructs to visualize YnbA distribution in the membrane

    • Use subcellular fractionation followed by Western blotting to confirm inner membrane localization

    • Apply super-resolution microscopy to identify potential clustering or specific localization patterns

  • Interaction Studies:

    • Perform pull-down assays with tagged YnbA to identify protein interaction partners

    • Use bacterial two-hybrid systems to confirm direct protein-protein interactions

    • Employ crosslinking studies to capture transient interactions within the membrane environment

  • Phenotypic Assays:

    • Test membrane permeability using fluorescent dyes

    • Assess susceptibility to various antibiotics and environmental stressors

    • Evaluate phospholipid composition changes in YnbA mutants using thin-layer chromatography or mass spectrometry

How can proteomics approaches reveal YnbA's functional networks?

Comprehensive proteomics analysis can uncover YnbA's position within cellular networks:

  • Comparative Proteomics: Compare protein expression profiles between wild-type and YnbA-deficient strains under various conditions. Similar approaches with YbfA revealed 323 differentially expressed proteins when comparing wild-type and knockout strains .

  • Phospholipidomics: Analyze changes in membrane phospholipid composition to determine if YnbA directly affects lipid synthesis or membrane organization, given its CDP-alcohol phosphatidyltransferase domain .

  • Proximity-based Labeling: Employ techniques like BioID or APEX2 to identify proteins that spatially interact with YnbA in the native membrane environment.

  • Temporal Proteomics: Analyze changes in the proteome at different growth phases to understand when YnbA activity is most critical.

These approaches can be combined with bioinformatic pathway analysis to place YnbA within larger functional networks and identify potential regulatory connections.

How might YnbA be involved in antimicrobial resistance mechanisms?

Given that inner membrane proteins can contribute to antimicrobial resistance, YnbA's potential role warrants investigation:

  • Comparative Sensitivity Analysis: Similar to studies with YbfA, which showed altered sensitivity to bacteriocins , researchers should compare the MIC (Minimum Inhibitory Concentration) values of various antibiotics between wild-type and YnbA-deficient strains.

  • Membrane Integrity Assessment: Electron microscopy can reveal whether YnbA deletion alters membrane morphology or integrity when cells are exposed to antimicrobials, similar to observations with YbfA and plantaricin BM-1 .

  • Regulatory Network Analysis: Investigate whether YnbA interacts with known antibiotic resistance regulatory systems. For example, research could examine potential connections to two-component systems like BasS/BasR, which has been shown to affect sensitivity to antimicrobial compounds in other studies .

  • Efflux Pump Function: Assess whether YnbA affects the function of membrane efflux pumps that contribute to antibiotic resistance.

This research direction is particularly relevant considering the increasing challenges of antimicrobial resistance in clinical settings.

What is the relationship between YnbA expression and cell growth dynamics?

The balance between recombinant protein production and cell growth deserves careful investigation:

  • Growth Curve Analysis: Compare growth rates between wild-type cells and those overexpressing YnbA. Research on recombinant protein expression indicates that higher accessibility of translation initiation sites leads to higher protein production but slower cell growth .

  • Metabolic Burden Assessment: Quantify metabolic changes associated with YnbA overexpression, which may support the "protein cost" hypothesis where cell growth is constrained by protein circuits during overexpression .

  • Stochastic Modeling: Develop simulation models to predict how varying YnbA expression levels affect cell growth and membrane composition over time, building upon existing frameworks used for other recombinant proteins .

A comparative data table showing projected relationships between YnbA expression level and growth parameters might include:

YnbA Expression LevelExpected Growth RateMembrane IntegrityMetabolic Burden
Wild-type (normal)BaselineNormalLow
Moderate overexpressionSlightly reducedMinor alterationsModerate
High overexpressionSignificantly reducedPotential disruptionHigh
Knockout/deletionVariable (function-dependent)Potentially alteredFunction-dependent

How can researchers overcome the challenges of YnbA crystallization for structural studies?

Membrane protein crystallization presents significant challenges that can be addressed through:

  • Detergent Screening: Systematically test different detergents and lipid-like compounds (including novel amphipols and nanodiscs) to identify conditions that maintain YnbA in a native-like conformation.

  • Fusion Protein Approach: Create fusion constructs with crystallization chaperones like T4 lysozyme or BRIL inserted into one of the loop regions to increase polar surface area for crystal contacts.

  • LCP Crystallization: Employ lipidic cubic phase (LCP) techniques, which have proven successful for many recalcitrant membrane proteins.

  • Alternative Structural Methods: Consider complementary approaches such as cryo-electron microscopy (cryo-EM) or nuclear magnetic resonance (NMR) for structural characterization if crystallization proves persistently difficult.

  • Computational Prediction: Use advanced protein structure prediction algorithms (such as AlphaFold) to generate initial structural models that can guide experimental design.

What strategies can optimize YnbA functionality studies in heterologous expression systems?

When studying YnbA in non-native contexts, researchers should consider:

  • Expression Host Selection: Choose expression hosts based on research questions—E. coli for basic characterization, but consider mammalian or insect cells for interaction studies with eukaryotic proteins.

  • Codon Optimization: Implement synonymous codon substitutions that maintain amino acid sequence while optimizing for the expression host. This has been shown to significantly affect expression levels in recombinant protein studies .

  • Temperature Modulation: Titrate expression temperature to balance between protein yield and proper membrane insertion. Lower temperatures (16-25°C) often favor proper folding of membrane proteins.

  • Induction Strategy: Test various inducer concentrations and induction timing to identify conditions that maximize functional protein production while minimizing toxicity.

  • Fusion Tags: Evaluate different fusion tags not just for purification but for proper membrane localization and folding. Consider removable tags with precise proteases to obtain the native protein after purification.

How can transcriptomics data enhance our understanding of YnbA regulation?

Integrating RNA-seq and other transcriptomic approaches can provide valuable insights:

  • Condition-Specific Expression: Analyze YnbA expression under various stress conditions (osmotic, pH, temperature, nutrient limitation) to identify when its expression is most critical.

  • Regulatory Element Identification: Map transcription factor binding sites and other regulatory elements in the promoter region of YnbA to understand its transcriptional control.

  • Co-expression Network Analysis: Identify genes consistently co-expressed with YnbA to infer functional relationships and potential operonic structures.

  • sRNA Regulation: Investigate potential small RNA regulators that might modulate YnbA expression post-transcriptionally.

  • Comparative Genomics: Analyze YnbA homologs across bacterial species to identify conserved regulatory mechanisms and functional importance.

This systems-level view can contextualize YnbA within broader cellular processes and guide more targeted functional studies.

What bioinformatic approaches can predict YnbA functional partners?

Computational methods can accelerate discovery of YnbA's functional network:

  • Protein-Protein Interaction Prediction: Use tools like STRING, STITCH, or PrePPI to identify potential interaction partners based on co-expression, genomic context, and experimental data.

  • Domain-Based Analysis: Identify proteins with complementary domains that might interact with YnbA's CDP-alcohol phosphatidyltransferase domain .

  • Phylogenetic Profiling: Analyze co-evolution patterns of YnbA with other genes across bacterial species to identify functionally related proteins.

  • Metabolic Pathway Integration: Map YnbA to known phospholipid biosynthesis pathways to identify potential substrates, products, and enzymatic partners.

  • Structural Docking: Use computational docking to predict potential interactions between YnbA and candidate partner proteins or small molecules.

These predictions should generate testable hypotheses for experimental validation using the techniques described in previous sections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.