Recombinant Escherichia coli Inner membrane protein yohK (yohK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order remarks. We will prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yohK; b2142; JW2130; Inner membrane protein YohK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yohK
Target Protein Sequence
MMANIWWSLPLTLIVFFAARKLAARYKFPLLNPLLVAMVVIIPFLMLTGISYDSYFKGSE VLNDLLQPAVVALAYPLYEQLHQIRARWKSIITICFIGSVVAMVTGTSVALLMGASPEIA ASILPKSVTTPIAMAVGGSIGGIPAISAVCVIFVGILGAVFGHTLLNAMRIRTKAARGLA MGTASHALGTARCAELDYQEGAFSSLALVLCGIITSLIAPFLFPIILAVMG
Uniprot No.

Target Background

Database Links
Protein Families
YohK (E.coli)/YwbG (IPA-22R) (B.subtilis) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is yohK protein and what characterizes its expression in E. coli?

YohK is an inner membrane protein in Escherichia coli with characteristics similar to other membrane-associated proteins such as YqjD. Based on established research patterns with similar proteins, yohK is likely expressed during specific growth phases and may be regulated by growth-phase specific sigma factors. For example, YqjD expression is controlled by the stationary phase sigma factor RpoS (σs), with expression increasing during the transition from exponential to stationary phase . Researchers investigating yohK should consider analyzing its expression patterns across different growth phases using techniques such as quantitative PCR and western blotting to establish baseline expression profiles.

When studying yohK, it's advisable to consider potential interactions with ribosomes and other cellular components, as seen with YqjD, which associates with 70S and 100S ribosomes at its N-terminal region . The physiological significance of these interactions may provide insights into yohK's function within the bacterial cell membrane system.

What expression systems are most suitable for recombinant yohK production?

For expressing inner membrane proteins like yohK, E. coli-based expression systems remain the preferred choice for many researchers due to their simplicity and cost-effectiveness. When selecting an expression system, consider the following parameters:

  • E. coli strain selection: JM109(DE3) cells have shown efficacy for expressing membrane proteins in large-scale production, as demonstrated with other recombinant proteins .

  • Plasmid vector design: Construct a plasmid vector containing unique restriction sites that allow for cassette mutagenesis, enabling the production of protein variants for structure-function analysis .

  • Induction conditions: Variables including temperature, induction time, and inducer concentration significantly impact membrane protein expression efficiency. For example, lower induction temperatures (15-25°C) often improve proper membrane protein folding and insertion.

  • Co-expression considerations: For challenging membrane proteins, co-expression with molecular chaperones may improve yields, though some membrane proteins can be expressed without this step .

What are the key structural and functional characteristics to consider when studying yohK?

When investigating yohK, researchers should examine:

  • Transmembrane domains: Like YqjD, which possesses a transmembrane motif in its C-terminal region , yohK likely contains hydrophobic regions that facilitate membrane integration.

  • Protein topology: Determining the orientation of yohK in the membrane (which domains face cytoplasmic vs. periplasmic sides) is crucial for functional characterization.

  • Post-translational modifications: These can significantly affect protein function and stability.

  • Protein-protein interactions: Consider potential interactions with other membrane components or cytoplasmic partners that may influence function.

  • Growth phase-dependent expression: As observed with YqjD, yohK expression may vary significantly based on growth conditions and cellular stress .

How can I optimize the expression of recombinant yohK protein in E. coli?

Optimizing recombinant membrane protein expression requires systematic evaluation of multiple variables:

Table 1: Key Parameters for Optimizing yohK Expression

ParameterVariables to TestConsiderations
Temperature15°C, 25°C, 37°CLower temperatures often improve folding
Induction Time4h, 8h, overnightExtended induction at lower temperatures may improve yields
Inducer Concentration0.1mM, 0.5mM, 1.0mM IPTGLower concentrations may reduce toxicity
E. coli StrainBL21(DE3), C41(DE3), C43(DE3), JM109(DE3)C41/C43 strains are engineered for membrane protein expression
Media CompositionLB, TB, M9, 2xYTRich media can improve yields but may increase inclusion body formation

When optimizing expression conditions, follow this approach:

  • Conduct small-scale expression trials varying the above parameters

  • Analyze protein expression by SDS-PAGE and western blotting

  • Assess membrane integration through fractionation studies

  • Measure toxicity by monitoring growth curves

  • Scale up using optimal conditions

Similar to approaches used for recombinant hemoglobin production, experimentally assessing the combined effects of induction temperature, induction time and E. coli expression strain can significantly enhance protein yield and improve post-translational modifications .

What purification methods are most effective for isolating yohK protein?

Purification of inner membrane proteins requires specialized approaches:

  • Membrane isolation: Harvest cells during optimal expression phase (likely early stationary phase based on YqjD patterns ). Disrupt cells using a French press or sonication followed by differential centrifugation to isolate membrane fractions.

  • Detergent screening: Test multiple detergents (DDM, LDAO, OG, etc.) for efficient extraction while maintaining protein structure. Begin with a panel of mild detergents at concentrations just above their critical micelle concentration (CMC).

  • Chromatography strategies:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Size exclusion chromatography for further purification and to assess oligomeric state

    • Ion exchange chromatography as a polishing step

  • Protein stability assessment: Monitor protein stability in different buffer conditions using dynamic light scattering or thermal shift assays.

Systematic comparison of different purification protocols, similar to the approach used in comparative systematic reviews, can help identify the most efficient method for obtaining high-quality protein preparations .

How can I confirm proper membrane localization of recombinant yohK?

Verification of proper membrane integration is critical and can be accomplished through:

  • Subcellular fractionation: Separate cytoplasmic, periplasmic, and membrane fractions through differential centrifugation and analyze via western blotting, as performed for YqjD which was found specifically in inner membrane fractions .

  • Fluorescence microscopy: Create GFP fusions to visualize membrane localization in vivo.

  • Protease accessibility assays: Use proteases to digest exposed regions of the protein in membrane vesicles.

  • Functional assays: Develop assays to measure activity that depends on proper membrane insertion.

What approaches are recommended for studying protein-protein interactions involving yohK?

Several complementary approaches can be employed:

  • Co-immunoprecipitation: Use antibodies against yohK or potential partner proteins to identify interactions.

  • Bacterial two-hybrid systems: Adapted for membrane proteins to identify interacting partners.

  • Crosslinking studies: Chemical crosslinkers can capture transient interactions.

  • Blue native PAGE: To analyze native protein complexes from membranes.

  • Ribosome association studies: If yohK interacts with ribosomes like YqjD, analyze through sucrose gradient centrifugation and monitor co-sedimentation patterns .

How does the expression of yohK compare to other membrane proteins during different growth phases?

When investigating growth phase-dependent expression patterns:

  • Monitor protein levels at multiple time points from early exponential to late stationary phase using western blotting.

  • Quantify mRNA levels using RT-qPCR to determine if regulation occurs at the transcriptional level.

  • Analyze promoter elements to identify potential binding sites for phase-specific transcription factors like RpoS, which regulates YqjD expression .

  • Consider constructing reporter fusions (e.g., yohK promoter-GFP) to visualize expression patterns at the single-cell level.

  • Compare expression patterns under various stress conditions (nutrient limitation, pH stress, osmotic stress) to identify regulatory mechanisms.

YqjD expression increases during the transition from exponential to stationary phase and reaches maximum levels after approximately 2 days of culture . Similar time-course experiments would be valuable for characterizing yohK expression dynamics.

What challenges exist in structural studies of yohK and how can they be addressed?

Membrane protein structural studies present several challenges:

  • Protein stability: Membrane proteins often denature outside their native lipid environment. Screen multiple detergents and consider adding lipids or using nanodiscs/liposomes to maintain stability.

  • Crystallization difficulties: Traditional crystallization methods have low success rates with membrane proteins. Consider:

    • Lipidic cubic phase crystallization

    • Creating fusion proteins with crystallization chaperones

    • Using antibody fragments to stabilize specific conformations

  • NMR spectroscopy challenges: Size limitations and signal broadening can complicate NMR studies. Consider:

    • Selective isotope labeling strategies

    • Solid-state NMR approaches

    • Studying isolated domains separately

  • Cryo-EM approaches: Recent advances in cryo-EM have revolutionized membrane protein structural biology. For smaller proteins like yohK, consider:

    • Incorporating into larger assemblies or nanodiscs

    • Using Fab fragments to increase particle size

    • Employing computational methods to enhance resolution

How can site-directed mutagenesis be used to study yohK function?

A systematic mutagenesis approach can provide valuable insights:

  • Alanine scanning: Systematically replace conserved residues with alanine to identify functionally important amino acids.

  • Transmembrane domain alterations: Modify hydrophobic regions to assess their role in membrane integration and function.

  • Charge substitutions: Introduce charge reversals or neutralizations to study electrostatic interactions.

  • Domain swapping: Exchange domains with related proteins to identify functional regions.

  • Cassette mutagenesis: Utilize plasmid constructs with unique restriction sites to facilitate efficient generation of multiple variants .

For each mutant, assess:

  • Expression levels and membrane localization

  • Protein stability and folding

  • Functional activity using appropriate assays

  • Interactions with partner proteins or other cellular components

How do I address low expression yields of recombinant yohK?

When facing low expression yields:

  • Codon optimization: Analyze the yohK sequence for rare codons in E. coli and consider synthesizing a codon-optimized gene.

  • Reduce toxicity: If yohK overexpression is toxic (as observed with YqjD ), consider:

    • Using tightly regulated expression systems

    • Lower inducer concentrations

    • Shorter induction times

    • Specialized E. coli strains like C41/C43 designed for toxic protein expression

  • Fusion partners: N-terminal fusion partners like MBP or SUMO can improve expression and solubility.

  • Growth conditions: Systematically vary media composition, temperature, and aeration to identify optimal conditions.

  • Expression timing: If yohK expression is growth-phase dependent like YqjD, timing the induction to match natural expression patterns may improve yields .

What strategies help resolve data inconsistencies in functional studies?

When encountering contradictory or inconsistent data:

  • Standardize experimental conditions: Ensure consistent:

    • Growth conditions (media, temperature, aeration)

    • Expression parameters (inducer concentration, time)

    • Purification protocols

    • Buffer compositions

  • Control for protein quality: Implement quality control measures:

    • Size exclusion chromatography to confirm monodispersity

    • Circular dichroism to assess secondary structure

    • Activity assays to confirm functionality

  • Multiple complementary approaches: Validate findings using different techniques:

    • In vivo and in vitro studies

    • Genetic and biochemical approaches

    • Structural and functional analyses

  • Biological replicates: Perform sufficient biological replicates (n≥3) to account for variability.

  • Independent validation: Consider having key experiments reproduced by different researchers or laboratories, similar to the comparative approach used in systematic reviews of clinical trials .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.