Recombinant Escherichia coli Inner membrane protein yphA (yphA)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Recombinant YphA is typically expressed in E. coli strains optimized for membrane protein production, such as BL21(DE3) or specialized strains like SuptoxD/SuptoxR . Key steps include:

  • Cloning: The yphA gene is cloned into vectors (e.g., pASK75) under inducible promoters (e.g., T7 or tetracycline-responsive) .

  • Expression: Induction with anhydrotetracycline or IPTG at mid-log phase (OD₆₀₀ ~0.5) enhances yield .

  • Membrane Localization: YphA partitions into inner membrane vesicles (IMVs), confirmed via sucrose density centrifugation .

  • Purification: Detergent extraction (e.g., DDM) followed by affinity chromatography isolates functional YphA .

Challenges:

  • Low solubility necessitates mild detergents for extraction.

  • Overexpression may require toxicity-suppressing strains (e.g., SuptoxD) .

Functional Insights

While YphA’s exact role is unclear, homologs in enterobacteria suggest involvement in:

  • Stress Response: Linked to extracytoplasmic stress pathways like Bae or Cpx .

  • Membrane Biogenesis: Potential interactions with Sec or YidC translocons during folding .

ELISA-Based Detection

A commercial ELISA kit (CSB-CF364913ENV) enables quantitative detection of recombinant YphA :

  • Sensitivity: Anti-HA or custom antibodies detect surface-exposed epitopes.

  • Applications: Monitoring expression levels under stress conditions or during purification.

Technical Considerations

Table 2: Recommended Protocols for YphA Handling

ParameterRecommendation
Expression StrainBL21(DE3) or SuptoxD/SuptoxR
Induction Temperature30°C (to minimize aggregation)
Storage Conditions-20°C in Tris-glycerol buffer; avoid freeze-thaw
Detergent CompatibilityDDM (0.1–2× CMC) or LMNG for solubilization

Future Directions

  • Functional Annotation: CRISPR-based knockout studies could elucidate YphA’s role in membrane integrity.

  • Structural Resolution: Cryo-EM or NMR in Omp8-deficient strains (e.g., BL21ΔABCF) may resolve its 3D structure .

  • Biotechnological Use: Engineering YphA as a fusion partner could enhance membrane protein stability during overexpression .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
yphA; b2543; JW2527; Inner membrane protein YphA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yphA
Target Protein Sequence
MNTLRYFDFGAARPVLLLIARIAVVLIFIIFGFPKMMGFDGTVQYMASLGAPMPMLAAII AVVMEVPAAILIVLGFFTRPLAVLFIFYTLGTAVIGHHYWDMTGDAVGPNMINFWKNVSI AGAFLLLAITGPGAISLDRR
Uniprot No.

Target Background

Database Links
Protein Families
DoxX family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the yphA protein and what is its function in E. coli?

The yphA protein is an inner membrane protein found in Escherichia coli. While specific functional characterization of yphA remains limited, it belongs to the class of integral membrane proteins that reside in the inner membrane of this gram-negative bacterium. Like other inner membrane proteins, it likely plays roles in cellular processes such as transport, signaling, or maintaining membrane integrity. Current research efforts are directed toward full functional characterization through recombinant expression and subsequent analysis .

What expression systems are most suitable for producing recombinant yphA?

For recombinant expression of E. coli inner membrane proteins like yphA, several expression systems have demonstrated efficacy. The pET and pMAL expression vectors represent powerful options, with distinct advantages for different research purposes. The pET system offers high expression levels under strong promoters but may lead to increased susceptibility to host cell proteases . In contrast, the pMAL system, which creates fusion proteins with the maltose-binding protein (MBP), often provides better protection against proteolytic degradation while maintaining protein solubility . For yphA specifically, the choice between these systems should be guided by experimental aims and downstream applications.

What are the key challenges in expressing inner membrane proteins like yphA?

The primary challenges in expressing inner membrane proteins include:

  • Protein misfolding and aggregation due to hydrophobic regions

  • Toxicity to host cells when overexpressed

  • Insufficient incorporation into membranes

  • Poor solubility in standard buffer systems

  • Susceptibility to proteolytic degradation

These challenges can be addressed through strategic approaches such as using specialized E. coli strains with reduced expression of competing native membrane proteins, optimizing induction conditions, and employing fusion partners that enhance solubility and stability .

How can deletion mutant strains improve the expression of recombinant membrane proteins like yphA?

Deletion mutant strains, such as those lacking major outer membrane proteins (OMPs), have demonstrated significant enhancement of recombinant membrane protein expression. The BL21ΔABCF strain, which lacks four abundant OMPs (OmpA, OmpC, OmpF, and LamB), has shown superior performance in expressing various membrane proteins . The mechanism behind this improvement involves:

  • Reduced competition for membrane insertion machinery

  • Decreased stress on the envelope folding pathways

  • Increased availability of chaperones and other folding factors

  • Enhanced incorporation efficiency of recombinant proteins

For inner membrane proteins like yphA, these advantages might be particularly valuable when high expression levels are required for structural or functional studies .

What fusion tags are recommended for enhancing yphA solubility and purification?

Based on successful approaches with other membrane proteins, the following fusion tags may enhance yphA solubility and purification:

Fusion TagBenefitsCleavage MethodPurification Method
MBP (Maltose-Binding Protein)Enhanced solubility, resistance to proteolysisFactor Xa or enterokinaseAmylose resin affinity chromatography
His6/His10Minimal size impact, versatile purificationTEV or thrombinIMAC (Ni-NTA) chromatography
StrepIIHighly specific binding, mild elutionTEV proteaseStrep-Tactin affinity chromatography
GSTEnhanced solubilityThrombin or PreScissionGlutathione affinity chromatography

The MBP fusion system has demonstrated particular success with membrane proteins, allowing for efficient purification via affinity chromatography on amylose resin and subsequent tag removal using specific proteases like factor Xa or enterokinase .

What is the optimal purification strategy for obtaining high-quality yphA protein?

A comprehensive purification strategy for yphA would typically involve:

  • Initial extraction: Using mild detergents (DDM, LDAO, or C12E8) to solubilize the protein from membranes

  • Affinity chromatography: Leveraging fusion tags (e.g., MBP) for initial capture

  • Tag removal: Enzymatic cleavage with specific proteases (factor Xa or enterokinase)

  • Secondary purification: Ion-exchange (DEAE) or hydroxyapatite chromatography to separate cleaved protein from tag and other contaminants

  • Size-exclusion chromatography: To isolate properly folded monomeric/oligomeric species from aggregates

  • Quality assessment: Using SDS-PAGE, Western blot, and activity assays to confirm purity and folding

This approach has yielded approximately 10 mg of highly purified protein per liter of culture for other membrane proteins and could be adapted for yphA .

How can researchers determine if recombinant yphA is correctly folded and functional?

Assessing proper folding and functionality of recombinant yphA requires multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy: To evaluate secondary structure content

  • Thermal denaturation assays: To determine protein stability

  • NMR studies: For detailed structural information, particularly with isotopically labeled protein

  • Binding assays: If ligands or interaction partners are known

  • Reconstitution into liposomes: To evaluate membrane integration and potential transport activities

  • Whole-cell ELISA: If surface expression can be detected with appropriate antibodies

These techniques have been successfully applied to other membrane proteins, such as the FepA outer membrane transporter, to distinguish between folded and unfolded states and assess functionality .

What strategies can be used to study yphA's membrane topology and structure?

Several complementary methods can elucidate yphA's membrane topology and structure:

  • Cysteine scanning mutagenesis: Introducing cysteine residues at specific positions and assessing their accessibility to membrane-impermeable reagents

  • Protease protection assays: Determining which regions are protected by the membrane

  • Reporter fusion analysis: Fusing topology reporters (e.g., PhoA, GFP) to different portions of the protein

  • Structural prediction algorithms: Using computational tools specifically designed for membrane proteins

  • Cryo-electron microscopy: For higher-resolution structural information of purified protein

  • X-ray crystallography: If crystals can be obtained, often using lipidic cubic phase approaches

These methods have proven valuable for characterizing membrane protein structure in cases where high-resolution crystal structures are challenging to obtain .

How can protein engineering be applied to enhance yphA stability and crystallization properties?

Advanced protein engineering approaches to enhance yphA stability and crystallization include:

  • Surface entropy reduction: Replacing flexible, high-entropy surface residues with alanines

  • Thermostabilization: Systematic mutagenesis to identify stabilizing mutations

  • Fusion of crystallization chaperones: Adding well-folded, crystallizable domains

  • Loop truncation or modification: Reducing flexibility of extramembranous loops

  • Disulfide engineering: Introducing disulfides to stabilize tertiary structure

  • Domain swapping: Replacing domains with homologous thermostable variants

These strategies have successfully facilitated crystallization of challenging membrane proteins and could be adapted for yphA structural studies .

What techniques can be used to study protein-protein interactions involving yphA?

To investigate protein-protein interactions involving yphA, researchers can employ:

  • Co-immunoprecipitation: Using antibodies against yphA or potential binding partners

  • Bacterial two-hybrid systems: Modified for membrane protein analysis

  • Chemical cross-linking coupled with mass spectrometry: To capture transient interactions

  • FRET/BRET assays: For detecting interactions in living cells

  • Surface plasmon resonance: Using purified components to measure binding kinetics

  • Proximity labeling approaches: Such as BioID or APEX2 fusion proteins to identify proximal proteins in vivo

These approaches provide complementary information about interaction networks and can identify novel binding partners of inner membrane proteins like yphA .

How can researchers investigate the potential role of yphA in bacterial physiology?

To investigate yphA's physiological role, researchers should consider:

  • Gene knockout studies: Creating yphA deletion strains and assessing phenotypic changes

  • Transcriptional profiling: Analyzing expression changes in response to environmental conditions

  • Conditional expression systems: Controlling yphA levels to observe dose-dependent effects

  • Growth under various stress conditions: Testing sensitivity to antibiotics, pH, osmolarity, etc.

  • Transport assays: If yphA is suspected to function in transport

  • Metabolomic analysis: Identifying metabolic pathways affected by yphA manipulation

These approaches have been instrumental in defining the functions of other E. coli membrane proteins and would provide valuable insights into yphA's role .

How can researchers overcome low expression yields of recombinant yphA?

To address low expression yields of yphA, researchers should consider implementing:

  • Strain optimization: Using specialized expression strains like BL21ΔABCF with reduced native membrane proteins

  • Codon optimization: Adapting the coding sequence to E. coli codon usage preferences

  • Promoter strength modulation: Testing different promoter systems (T7, tac, araBAD)

  • Induction condition optimization: Systematically varying temperature, inducer concentration, and duration

  • Co-expression of chaperones: Including membrane protein-specific folding factors

  • Growth media optimization: Testing enriched media formulations or supplementation with specific components

A comparative analysis of expression yields under different conditions can be quantitatively assessed using Western blotting or whole-cell ELISA methods, as demonstrated for other membrane proteins .

What strategies can resolve protein aggregation issues during yphA purification?

Protein aggregation during yphA purification can be addressed through:

  • Detergent screening: Testing diverse detergents and concentrations to identify optimal solubilization conditions

  • Buffer optimization: Adjusting pH, ionic strength, and additive composition

  • Addition of stabilizing agents: Glycerol, specific lipids, or ligands that enhance stability

  • Temperature control: Maintaining low temperatures during all purification steps

  • Fusion with solubility-enhancing partners: MBP has shown particular success in preventing aggregation

  • Separation of aggregates: Using size-exclusion chromatography to isolate properly folded species

The effectiveness of these approaches can be monitored by analyzing the protein's oligomeric state and comparing the relative proportions of monomeric, oligomeric, and aggregated forms .

How can cryo-EM be applied to study the structure of yphA?

Cryo-electron microscopy (cryo-EM) offers powerful approaches for studying membrane proteins like yphA:

  • Sample preparation optimization: Testing various detergents, nanodiscs, or amphipols for optimal particle distribution

  • Data collection strategies: Employing the latest direct electron detectors and collection parameters

  • Image processing workflows: Using specialized software for membrane protein analysis

  • Validation methods: Implementing rigorous structure validation protocols

  • Integration with other structural data: Combining with information from complementary methods

The recent advances in cryo-EM technology make it particularly suitable for membrane proteins that resist crystallization, potentially allowing determination of yphA structure at near-atomic resolution .

What mass spectrometry approaches are most informative for yphA characterization?

Advanced mass spectrometry techniques for yphA characterization include:

  • Hydrogen-deuterium exchange MS: To probe protein dynamics and solvent accessibility

  • Crosslinking MS: For identifying interaction interfaces

  • Native MS: To determine oligomeric states in detergent micelles

  • Limited proteolysis coupled with MS: To identify domain boundaries and flexible regions

  • Post-translational modification analysis: Including phosphorylation states that may regulate function

  • Top-down proteomics: For analysis of intact protein and proteoforms

These approaches provide complementary information to traditional structural biology methods and can reveal functional aspects of yphA that might not be apparent from static structural data .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.