Recombinant Escherichia coli Inner membrane protein yqiJ (yqiJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yqiJ; b3050; JW3022; Inner membrane protein YqiJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yqiJ
Target Protein Sequence
MILFADYNTPYLFAISFVLLIGLLEIFALICGHMLSGALDAHLDHYDSITTGHISQALHY LNIGRLPALVVLCLLAGFFGLIGILLQHACIMVWQSPLSNLFVVPVSLLFTIIAVHYTGK IVAPWIPRDHSSAITEEEYIGSMALITGHQATSGNPCEGKLTDQFGQIHYLLLEPEEGKI FTKGDKVLIICRLSATRYLAENNPWPQIL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for recombinant YqiJ production?

For membrane proteins like YqiJ, expression optimization is critical due to potential toxicity and proper folding requirements. Current evidence suggests several viable expression systems:

Expression SystemAdvantagesLimitations
E. coliNative environment, high yield potential, cost-effectivePotential toxicity during overexpression
Yeast systemsPost-translational modifications, proper foldingLower yields than bacterial systems
BaculovirusProper folding of complex membrane proteinsMore complex protocol, higher cost
Cell-free expressionAvoids toxicity issues, rapid productionLower yields for membrane proteins

For YqiJ specifically, recombinant expression in E. coli with an N-terminal His tag has been successfully employed , though the protein must be maintained in appropriate detergent or membrane-mimetic environments following extraction to preserve its native conformation and functionality.

How can the purity and integrity of recombinant YqiJ be verified?

Recombinant YqiJ purity should be verified using multiple complementary methods:

  • SDS-PAGE analysis: Current standards indicate a purity threshold of ≥85% for research applications

  • Western blotting with anti-His antibodies (for His-tagged YqiJ)

  • Mass spectrometry to confirm molecular weight and sequence integrity

  • Size-exclusion chromatography to assess aggregation state

  • Circular dichroism to verify secondary structure content

When handling membrane proteins like YqiJ, it's essential to confirm that the protein maintains its expected structural characteristics following purification. Improper handling can lead to aggregation or denaturation, particularly when removed from stabilizing detergents or lipid environments.

What are appropriate controls when studying YqiJ function in membrane systems?

When designing experiments to investigate YqiJ function, several controls are essential:

Control TypePurposeImplementation
Empty vectorControls for expression system effectsTransform cells with expression vector lacking YqiJ insert
Inactive mutantDistinguishes specific from non-specific effectsGenerate point mutations in predicted functional domains
Related proteinControls for general membrane protein effectsExpress similar membrane protein from DUF1449 family
Environmental controlsIsolate conditions affecting membrane functionVary temperature, ionic strength, pH systematically

For statistical validity, experiments should follow proper design principles. The untreated control group design with dependent pretest and posttest samples represents one of the strongest quasi-experimental designs , where:

Intervention group: O₁ₐ X O₂ₐ
Control group: O₁ᵦ O₂ᵦ

Where O represents observations and X represents the experimental intervention.

How should researchers design studies to investigate YqiJ interactions with other cellular components?

Based on methodologies used for similar membrane proteins, a multi-tiered approach is recommended:

  • In silico analysis: Predict potential interaction partners using genomic context analysis, phylogenetic profiling, and co-expression data

  • Co-purification studies: Similar to approaches used for YjeQ , isolate membrane fractions and identify co-purifying proteins through mass spectrometry

  • Crosslinking experiments: Use membrane-permeable crosslinkers to capture transient interactions

  • Bacterial two-hybrid systems: Modified for membrane protein analysis

  • Co-localization studies: Fluorescently tag YqiJ and potential interacting partners

When interpreting results, researchers should be aware that membrane protein interactions may be condition-dependent. For example, evidence from studies of the YjeQ protein demonstrates its interaction with the 30S ribosomal subunit is strongest in the presence of non-hydrolyzable GTP analogs like GMP-PNP .

How does the subcellular localization of YqiJ change under different growth conditions?

The localization of membrane proteins can be dynamically regulated. While specific data for YqiJ is limited, methodological approaches can be adapted from studies of similar proteins like YqjD :

  • Express YqiJ with fluorescent protein fusions and monitor distribution under varying conditions:

    • Exponential vs. stationary phase

    • Nutrient limitation

    • Osmotic stress

    • Temperature variation

  • Use cell fractionation coupled with Western blotting to quantitatively assess distribution between:

    • Inner membrane fractions

    • Soluble cytoplasmic fractions

    • Possible interaction with ribosomal components

  • Employ detergent and salt washes of increasing stringency to assess the strength of membrane association under different conditions

YqjD studies demonstrated that some membrane proteins show dynamic expression patterns, with maximal expression during stationary phase and regulation by transcription factors like RpoS . Similar regulatory mechanisms may exist for YqiJ and could be examined through promoter-reporter fusion assays.

How can contradictory functional data for YqiJ be reconciled using integrative approaches?

When faced with conflicting functional data for membrane proteins like YqiJ, a systematic approach is necessary:

  • Meta-analysis framework:

    • Categorize experimental approaches by methodology

    • Assess potential biases in each experimental system

    • Evaluate statistical power of contradictory studies

  • Integrative experimental design:

    • Combine multiple methodologies within single studies

    • Use both in vivo and in vitro approaches

    • Apply time-resolved techniques to capture dynamic behaviors

  • Strain-specific considerations:

    • Compare results across different E. coli strains

    • Assess genomic context differences

    • Consider strain-specific regulatory networks

The experimental designs should incorporate multiple pretest and posttest observations to establish reliable baselines and assess responses over time.

What methodologies are most effective for studying YqiJ interactions with the ribosome?

Based on successful approaches used for YjeQ and YqjD , the following methodologies would be effective for studying YqiJ-ribosome interactions:

  • Co-purification studies: Isolate ribosomes from wild-type E. coli using ultracentrifugation and verify YqiJ association through Western blotting with anti-YqiJ antibodies

  • Salt and detergent stringency tests: Apply washes of increasing ionic strength (from 60 mM to 1 M NH₄Cl) to assess the strength of interaction, as performed for YjeQ

  • In vitro binding assays: Use purified components to measure:

    • Binding kinetics (SPR or BLI)

    • Binding stoichiometry

    • Nucleotide dependence of interaction

  • Mutational analysis: Create N-terminal and C-terminal truncation variants to delineate binding domains

  • Cryo-EM structural analysis: Determine the structural basis of the interaction

When interpreting results, consider that similar to YjeQ and YqjD, YqiJ may exhibit condition-dependent interactions with cellular components, possibly regulated by stress factors or growth phase .

How can researchers distinguish between direct and indirect interactions of YqiJ with other membrane proteins?

Distinguishing direct from indirect interactions requires multi-layered approaches:

  • In vitro reconstitution:

    • Purify YqiJ and potential interacting partners

    • Reconstitute in defined lipid environments (liposomes, nanodiscs)

    • Apply proximity-based labeling methods (APEX2, BioID)

  • Genetic approaches:

    • Synthetic genetic arrays to identify epistatic relationships

    • Suppressor screens to identify functional relationships

  • Structural methods:

    • Cross-linking coupled with mass spectrometry (XL-MS)

    • Förster resonance energy transfer (FRET)

    • Single-molecule tracking in live cells

  • Computational validation:

    • Molecular docking and dynamics simulations

    • Coevolution analysis of sequence data

For valid experimental design, researchers should apply between-subjects designs with proper controls and randomization to ensure that observed interactions are not artifacts of the experimental system.

How can researchers integrate YqiJ studies with systems biology approaches?

Integration with systems biology approaches enables comprehensive understanding of YqiJ function:

  • Multi-omics integration:

    • Transcriptomics: RNA-Seq to identify genes differentially expressed in YqiJ mutants

    • Proteomics: Quantitative proteomics to assess changes in protein abundance and post-translational modifications

    • Metabolomics: Measure changes in metabolite profiles associated with YqiJ function

    • Lipidomics: Characterize membrane lipid composition changes

  • Network analysis:

    • Integrate data into protein-protein interaction networks

    • Perform pathway enrichment analysis

    • Identify functional modules affected by YqiJ

  • Genome-scale modeling:

    • Incorporate YqiJ function into genome-scale metabolic models

    • Perform flux balance analysis to predict physiological effects

    • Validate model predictions experimentally

  • Comparative genomics:

    • Analyze conservation and evolution of YqiJ across bacterial species

    • Identify genomic context patterns to infer function

When designing these integrative studies, researchers should apply the experimental design principles outlined in multiple sources to ensure statistical validity and interpretability of complex datasets.

What are the challenges and solutions in developing antibodies specific to YqiJ for research applications?

Developing specific antibodies against membrane proteins like YqiJ presents unique challenges:

ChallengeSolutionMethodology
HydrophobicityUse hydrophilic segments as antigensGenerate peptide antibodies against predicted extramembrane loops
Conformational epitopesMaintain native structureUse detergent-solubilized or nanodisc-incorporated protein as antigen
Low immunogenicityEnhanced adjuvant formulationsUse KLH conjugation and specialized adjuvant systems
Cross-reactivityExtensive validationTest against knockout strains and related proteins

For validation, researchers should implement:

  • Western blot analysis against wild-type and YqiJ knockout strains

  • Immunoprecipitation followed by mass spectrometry

  • Immunofluorescence microscopy to verify localization patterns

  • Pre-adsorption controls with purified antigen

Commercial antibodies against Escherichia coli YqiJ are available , but researchers should perform validation studies to ensure specificity for their experimental systems.

How can advanced imaging techniques be optimized to study YqiJ localization and dynamics in living cells?

Advanced imaging techniques can provide unprecedented insights into YqiJ behavior:

  • Super-resolution microscopy approaches:

    • Photoactivated localization microscopy (PALM)

    • Stochastic optical reconstruction microscopy (STORM)

    • Stimulated emission depletion (STED) microscopy

  • Live-cell imaging optimizations:

    • Minimally invasive tagging strategies (small tags like HaloTag or SNAP-tag)

    • Balanced expression levels to prevent artifacts

    • Photobleaching minimization protocols

  • Sample preparation considerations:

    • Microfluidic systems for precise environmental control

    • Immobilization strategies optimized for bacterial cells

    • Membrane-specific staining for colocalization

  • Analysis workflows:

    • Single-particle tracking for dynamic studies

    • Spatial statistics for distribution patterns

    • Correlation analysis for colocalization studies

To ensure rigor, experiments should be designed with appropriate controls following the quasi-experimental design principles adapted for imaging studies, including technical replicates and statistical validation of observed patterns.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.