Recombinant Escherichia coli Inner membrane transport permease yadH (yadH)

Shipped with Ice Packs
In Stock

Description

Introduction to Bacterial Membrane Transport Systems

Gram-negative bacteria like E. coli possess a complex cell envelope consisting of an inner membrane, periplasmic space, and outer membrane. These structures depend on specialized transport proteins to maintain cellular homeostasis, facilitate nutrient uptake, and ensure proper membrane organization. Membrane transport permeases represent a diverse group of proteins that mediate the movement of molecules across bacterial membranes, playing crucial roles in bacterial survival and adaptation to environmental changes.

The bacterial cell envelope proteins (CEPs) form numerous complexes that mediate essential processes including membrane assembly, antibiotic resistance, and metabolic coordination. These protein complexes constitute an intricate network that maintains the structural and functional integrity of bacterial cells. Recent proteomic surveys have identified and characterized approximately 1,347 CEPs, representing about 90% of inner membrane, outer membrane, and periplasmic proteins in E. coli .

Classification of E. coli Membrane Transporters

E. coli possesses several types of membrane transport systems, each with distinct structural features and energy coupling mechanisms:

Transport System TypeEnergy SourceGeneral StructureExample Functions
ABC Transporters (including YadH)ATP hydrolysisTransmembrane domains + Nucleotide-binding domainsNutrient import, lipid trafficking, drug efflux
Secondary Active TransportersIon gradientsMultipass membrane proteinsAmino acid transport, sugar uptake
Phosphotransferase SystemsPhosphoenolpyruvateMulticomponent systemsCarbohydrate uptake and phosphorylation
Ion ChannelsElectrochemical gradientPore-forming proteinsIon movement, osmoregulation

YadH belongs to the ABC (ATP-Binding Cassette) transporter family, which uses the energy from ATP hydrolysis to drive transport processes across membranes. ABC transporters are widely distributed in bacteria and play critical roles in cellular physiology.

YadH: An ABC Transporter Involved in Membrane Integrity

YadH has been identified as "an ABC transporter of unknown function" that works "together with the Mla system preserves outer membrane lipid asymmetry" in E. coli . This finding emerged from a comprehensive proteomic survey that mapped the physical interaction network of cell envelope proteins in E. coli.

Functional Role in Membrane Lipid Homeostasis

The primary known function of YadH is its participation in preserving outer membrane lipid asymmetry in E. coli, working in concert with the Mla (Maintenance of lipid asymmetry) system . This function is critical for maintaining the permeability barrier properties of the Gram-negative cell envelope.

Outer Membrane Lipid Asymmetry

The outer membrane of Gram-negative bacteria has a distinctive asymmetric structure:

Membrane LeafletPrimary Lipid ComponentsFunctional Significance
Outer LeafletLipopolysaccharides (LPS)Permeability barrier, immune evasion
Inner LeafletPhospholipidsMembrane stability, protein anchoring

Maintaining this asymmetry is essential for bacterial survival, as disruptions can lead to increased antibiotic susceptibility and compromised cell integrity. The research establishing YadH's role in this process represents an important advancement in understanding bacterial membrane homeostasis mechanisms.

YadH and the Mla System Interaction

The Mla system is a well-studied machinery involved in retrograde phospholipid transport. It helps maintain outer membrane lipid asymmetry by removing mislocalized phospholipids from the outer leaflet of the outer membrane and returning them to the inner membrane. YadH's cooperation with this system suggests a coordinated mechanism for membrane lipid trafficking.

ComponentCellular LocationKnown/Proposed Function
YadHInner membraneABC transporter working with Mla system
MlaAOuter membraneExtracts phospholipids from outer membrane
MlaCPeriplasmShuttles phospholipids across periplasm
MlaD/E/FInner membraneForms ABC transporter complex

The identification of YadH as a functional partner of the Mla system adds an important piece to understanding the complex machinery maintaining bacterial membrane organization.

Recombinant Production of Membrane Proteins

Recombinant production of membrane proteins like YadH presents significant challenges due to their hydrophobic nature and complex membrane insertion requirements. Understanding the factors affecting successful expression is crucial for structural and functional studies.

Expression Systems for Membrane Proteins

Several factors influence the successful recombinant production of membrane proteins in E. coli:

ParameterConsiderationsImpact on Protein Production
Promoter SelectionStrength and regulation (PT7, Plac, PBAD)Affects expression timing and level
Plasmid Copy NumberHigh vs. low copy vectorsHigh copy can cause metabolic burden
Host StrainWild-type vs. specialized expression strainsDifferent strains have varying capacities for membrane protein production
Growth ConditionsTemperature, media composition, induction timingCan significantly affect folding and insertion efficiency

Research has shown that the combination of promoter strength and vector copy number significantly impacts recombinant protein yield. For instance, high copy number vectors have been associated with lower protein production compared to medium and low copy plasmids in some cases . For membrane proteins like YadH, the expression system must be carefully optimized to balance protein production with the cell's capacity for proper membrane insertion.

Challenges in Membrane Protein Expression

Membrane proteins face specific production challenges:

  1. Limited membrane space for insertion can lead to toxicity

  2. Protein misfolding and aggregation is common

  3. Proper folding often requires specific chaperones or insertion machinery

  4. Extraction and purification requires careful detergent selection

For ABC transporters like YadH, maintaining the native structure during expression and purification is particularly challenging but essential for functional studies.

Comparative Analysis with Other E. coli Transport Systems

While specific information about YadH is limited, understanding similar transport systems provides valuable context. Several well-characterized inner membrane transport systems in E. coli can inform our understanding of YadH's potential mechanisms and functions.

YhdP: Another Inner Membrane Protein with Transport Function

YhdP is an inner membrane protein involved in maintaining the outer membrane permeability barrier in E. coli. Research has demonstrated that YhdP modulates the rate of phospholipid transport, specifically during MlaA-mediated lysis . When deleted, YhdP reduces the rate of inner membrane to outer membrane phospholipid transport by approximately 50% . This suggests a role in facilitating phospholipid movement between membranes, potentially similar to YadH's function in maintaining membrane lipid asymmetry.

Dipeptide Permease (Dpp) System

The Dpp system in E. coli represents another important inner membrane transport system that, like YadH, belongs to the ABC transporter family. Research has established that the Dpp permease functions as the E. coli heme transporter, requiring the DppBCDF proteins as the ABC transporter components . This system demonstrates how ABC transporters can have specialized substrate recognition and transport functions in bacterial membranes.

Research Applications and Future Directions

Understanding YadH and its role in maintaining membrane integrity opens several research avenues with potential applications in biotechnology and medicine.

Antimicrobial Development Potential

The outer membrane of Gram-negative bacteria serves as a crucial barrier against antibiotics. Systems maintaining membrane integrity, like YadH, represent potential targets for novel antimicrobial strategies. Disrupting YadH function could potentially compromise membrane integrity, enhancing the efficacy of existing antibiotics or providing new vulnerability points.

Biotechnological Applications

Membrane transporters like YadH have potential applications in:

  1. Engineered bacteria for bioremediation of environmental pollutants

  2. Development of biosensors for detecting specific compounds

  3. Improved recombinant protein production systems

  4. Synthetic biology applications requiring controlled membrane transport

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yadH; b0128; JW0124; Inner membrane transport permease YadH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yadH
Target Protein Sequence
MMHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNLIGSRIGDMHGFSYMQ FIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHVIIAGYVGGGVARGLFV GILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVFAKTFDDISLVPTFVLTP LTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGINDVPLVTTFGVLVVFIVAF YLICWSLIQRGRGLRS
Uniprot No.

Target Background

Database Links
Protein Families
ABC-2 integral membrane protein family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YadH and what is its primary function in Escherichia coli?

YadH is an ABC (ATP-binding cassette) transporter located in the inner membrane of Escherichia coli. Current research identifies it as a multidrug resistance transporter with C3G (cyanidin 3-O-glucoside) exporting capability. The primary characterized function of YadH involves the export of anthocyanins, particularly C3G, from the bacterial cytoplasm to the extracellular environment . More recent studies have also established that YadH, in cooperation with the Mla system, plays a crucial role in preserving outer membrane lipid asymmetry in E. coli . This dual functionality positions YadH as an important component in both bacterial secondary metabolite transport and membrane integrity maintenance.

ABC transporters typically consist of transmembrane domains that form a pathway for substrates to cross the membrane and nucleotide-binding domains that power the transport through ATP hydrolysis. YadH represents one of the many ABC transporters in E. coli that contributes to cellular homeostasis and response to environmental conditions.

How does YadH contribute to anthocyanin production in recombinant E. coli?

YadH enhances anthocyanin production in recombinant E. coli primarily through its export function, which reduces potential toxicity and feedback inhibition of accumulated intracellular anthocyanins. Research has demonstrated that overexpression of YadH can increase C3G production by approximately 15% . This improvement occurs because:

  • Efficient export of C3G prevents intracellular accumulation that might otherwise inhibit biosynthetic enzymes.

  • Continuous removal of the product shifts the metabolic equilibrium toward increased production.

  • Reduced intracellular concentration minimizes potential toxicity effects of anthocyanins on bacterial cells.

The transport mechanism likely involves ATP hydrolysis to power the conformational changes required for substrate translocation across the membrane. Understanding this process is crucial for metabolic engineering efforts aimed at improving microbial production of valuable plant secondary metabolites like anthocyanins.

What protein families and structural features characterize the YadH transporter?

YadH belongs to the ATP-binding cassette (ABC) transporter superfamily, one of the largest and most ancient families of membrane transporters. As an inner membrane protein in E. coli, YadH exhibits characteristic structural features of ABC transporters:

  • Transmembrane domains (TMDs): Form the pathway through which substrates cross the membrane

  • Nucleotide-binding domains (NBDs): Bind and hydrolyze ATP to power transport

  • Substrate-binding regions: Determine specificity for transported molecules

YadH functions within a membrane protein complex (MPC), associating with four of six subunits of another cellular system . This association suggests that YadH may operate as part of a larger functional assembly rather than as an isolated transporter. The structural organization enables YadH to facilitate the directional transport of specific substrates across the inner membrane of E. coli.

The three-dimensional structure of YadH likely follows the general fold of ABC transporters, with multiple transmembrane alpha-helices and cytoplasmic domains containing the conserved Walker A and Walker B motifs characteristic of ATP-binding proteins.

What experimental approaches are most effective for characterizing YadH function in recombinant E. coli systems?

Characterizing YadH function requires complementary experimental approaches that address both its transport activity and physiological role. Based on published methodologies, the most effective strategies include:

Table 1: Experimental Approaches for YadH Characterization

ApproachMethodologyKey MeasurementsAdvantages
Genetic manipulationOverexpression and knockout studiesC3G production levels, cell growthDirect assessment of functional impact
Transport assaysRadioisotope or fluorescent substrate trackingTransport kinetics, substrate specificityQuantitative measurement of transport activity
Affinity purificationEndogenous tagging followed by MS analysisProtein-protein interactionsReveals integration within membrane complexes
Lipid asymmetry assessmentPhospholipid distribution analysisMembrane lipid compositionEvaluates role in membrane integrity
Parallel design experimentsTreatment/mediator manipulationCausal mechanism identificationEstablishes mechanistic relationships

For rigorous characterization, researchers should implement a systematic workflow beginning with genetic manipulation to establish phenotypic effects, followed by biochemical assays to characterize transport properties. Affinity purification coupled with mass spectrometry has proven particularly valuable for identifying YadH's integration within larger protein complexes, revealing its association with the Mla system in preserving outer membrane lipid asymmetry .

When designing these experiments, careful control of experimental conditions is essential. Specifically, the parallel design approach, which involves manipulating both the treatment (e.g., YadH expression level) and mediator (e.g., substrate availability), can effectively isolate the causal mechanisms through which YadH influences cellular phenotypes .

How does YadH interact with the Mla system to maintain outer membrane lipid asymmetry?

YadH's interaction with the Mla (Maintenance of lipid asymmetry) system represents a sophisticated mechanism for preserving the essential lipid organization in Gram-negative bacterial membranes. Current research indicates that:

  • YadH forms a physical complex with four of the six subunits of a broader system, likely the Mla components .

  • This association creates a functional bridge that spans Gram-negative cell envelope compartments.

  • The complex facilitates the retrograde transport of phospholipids from the outer leaflet of the outer membrane back to the inner membrane.

The molecular basis of this interaction likely involves specific protein-protein contact surfaces between YadH and Mla components. The process helps maintain the asymmetric distribution of phospholipids in the outer membrane, where lipopolysaccharides (LPS) predominantly occupy the outer leaflet while phospholipids are restricted to the inner leaflet.

This lipid asymmetry is critical for several reasons:

  • It contributes to the permeability barrier function of the outer membrane

  • It helps maintain cellular integrity against environmental stresses

  • It influences susceptibility to antimicrobial compounds

Disruption of this YadH-Mla interaction would likely result in phospholipid mislocalization, potentially compromising membrane integrity and antibiotic resistance properties of E. coli .

What are the implications of YadH activity for bacterial antibiotic resistance?

YadH's function as an ABC transporter and its role in membrane lipid asymmetry have significant implications for bacterial antibiotic resistance through multiple mechanisms:

  • Direct antibiotic efflux: As a member of the multidrug resistance transporter family, YadH may directly export certain antibiotics from the bacterial cell, reducing their intracellular concentration below effective levels .

  • Membrane permeability barrier: By maintaining outer membrane lipid asymmetry in cooperation with the Mla system, YadH helps preserve the permeability barrier that restricts entry of hydrophobic antibiotics .

  • Stress response integration: YadH likely participates in bacterial stress response pathways that are activated during antibiotic exposure.

  • Biofilm formation influence: Alterations in membrane composition affected by YadH may influence biofilm formation, which contributes to antibiotic tolerance.

Understanding these resistance mechanisms requires experimental approaches that can identify causal relationships. The parallel design methodology, which involves manipulating both treatment (antibiotic exposure) and mediator (YadH expression), can effectively isolate the specific contribution of YadH to resistance phenotypes .

Research targeting YadH inhibition may represent a strategy for enhancing antibiotic efficacy, particularly for compounds whose activity is limited by efflux or permeability barriers.

What expression systems are most effective for recombinant production of YadH?

Optimizing expression systems for membrane proteins like YadH presents unique challenges due to potential toxicity, proper folding requirements, and membrane integration needs. Based on current methodologies, the most effective expression systems include:

Table 2: Expression Systems for Recombinant YadH Production

Expression SystemKey FeaturesAdvantagesConsiderations
pBAD/araC-based vectorsArabinose-inducible, tunable expressionFine control of expression levelsMay require optimization of inducer concentration
T7-based systemsHigh-level expression potentialStrong production capabilityCan lead to toxicity without careful regulation
Dual-plasmid systemsSeparate vectors for YadH and interacting partnersStoichiometric controlRequires maintenance of multiple plasmids
Chromosomal integrationStable expression from genomePhysiological expression levelsLower yield than plasmid-based systems

For successful YadH expression, several critical factors should be considered:

  • Induction conditions: Gradual induction at lower temperatures (typically 18-25°C) often improves proper membrane integration.

  • Host strain selection: C41(DE3) or C43(DE3) E. coli strains, which are adapted for membrane protein expression, may provide superior results compared to standard laboratory strains.

  • Fusion tags: N-terminal tags (such as His6 or FLAG) positioned with appropriate linkers can facilitate purification while minimizing interference with membrane insertion.

  • Membrane extraction: Gentle solubilization using detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) helps maintain protein structure and function .

When evaluating expression efficacy, researchers should assess not only the total protein yield but also the fraction of correctly folded and membrane-integrated YadH, as this represents the functionally relevant population.

How can researchers effectively measure YadH transport activity in vivo and in vitro?

Measuring YadH transport activity requires specialized techniques to account for its membrane localization and substrate specificity. The following methodologies provide complementary approaches:

In vivo measurement approaches:

  • Whole-cell transport assays: Monitor the accumulation or efflux of fluorescent or radiolabeled substrates (such as labeled C3G) in cells with varying YadH expression levels. Time-course measurements can determine transport rates and substrate specificity .

  • Growth phenotype analysis: Compare growth of YadH-expressing versus knockout strains in the presence of potential toxic substrates or under conditions requiring YadH function.

  • Metabolite profiling: Quantify intracellular versus extracellular levels of transported compounds using HPLC or LC-MS/MS to assess transport efficiency.

In vitro measurement approaches:

  • Proteoliposome reconstitution: Purified YadH can be incorporated into artificial liposomes with controlled internal composition, allowing precise measurement of substrate transport across a defined membrane.

  • ATPase activity assays: Since YadH is an ABC transporter, its ATP hydrolysis activity can serve as a proxy for transport function, particularly when stimulated by transport substrates.

  • Surface plasmon resonance (SPR): This technique can be used to measure the binding kinetics between YadH and its substrates or inhibitors.

The experimental design for causal mechanism identification, particularly the parallel design approach described in the literature, offers a robust framework for determining the specific contribution of YadH to observed phenotypes . This approach involves two experiments: one where both the treatment (e.g., substrate) and mediator (YadH) vary naturally, and another where the mediator is experimentally manipulated, allowing researchers to isolate the causal role of YadH.

What analytical techniques best characterize YadH's role in membrane lipid organization?

Characterizing YadH's role in membrane lipid organization requires techniques that can assess lipid distribution, membrane dynamics, and protein-lipid interactions. The most informative analytical approaches include:

  • Mass spectrometry-based lipidomics: Provides comprehensive analysis of lipid composition in different membrane fractions. Using techniques like liquid chromatography-mass spectrometry (LC-MS), researchers can quantify phospholipid species in the inner and outer membranes to assess YadH's impact on lipid distribution .

  • Fluorescent lipid probes: Lipids labeled with environmentally-sensitive fluorophores can track lipid movement between membrane compartments in living cells. This approach allows real-time monitoring of lipid trafficking affected by YadH function.

  • Outer membrane vesicle (OMV) analysis: Characterizing the lipid composition of OMVs from wild-type versus YadH-deficient strains can reveal alterations in outer membrane organization.

  • Cryo-electron microscopy: This technique can visualize membrane structure at near-atomic resolution, potentially revealing YadH-dependent changes in membrane organization.

  • Protein-lipid interaction assays: Techniques like microscale thermophoresis or lipid overlay assays can identify specific lipid species that interact with YadH, informing its mechanism of action.

To establish causality between YadH activity and membrane organization, researchers should implement experimental designs that manipulate YadH expression or function while controlling for confounding factors. The crossover design approach described in the literature, which examines outcomes under different treatment conditions in the same experimental units, can be particularly valuable for isolating YadH's specific effects .

How can YadH be engineered to improve anthocyanin production in biotechnology applications?

Engineering YadH for enhanced anthocyanin production requires strategic modifications targeting its expression, substrate specificity, and transport efficiency. Based on current research, promising engineering approaches include:

Table 3: YadH Engineering Strategies for Improved Anthocyanin Production

Engineering ApproachMethodologyExpected OutcomeChallenges
Promoter optimizationReplace native promoter with stronger/tunable variantsIncreased YadH expressionPotential toxicity from overexpression
Directed evolutionRandom mutagenesis with selection for improved exportEnhanced transport efficiencyRequires effective screening method
Structure-guided mutagenesisTargeted amino acid substitutions in substrate binding regionsAltered substrate specificityRequires structural information
Fusion protein constructionAddition of domains that enhance membrane integration or stabilityImproved functional expressionMay affect transport activity
Synthetic operon designCo-expression with Mla components or other partnersOptimized complex formationRequires balancing expression levels

Current research indicates that overexpression of YadH can increase C3G production by approximately 15% , but more substantial improvements may be achievable through more sophisticated engineering. When implementing these strategies, researchers should consider:

  • The potential for transport saturation, which may necessitate concurrent engineering of metabolic pathways

  • The energetic burden of ABC transporter operation, which requires ATP expenditure

  • The importance of maintaining membrane integrity while enhancing transport function

The identification of multiple E. coli multidrug resistance transporters with C3G-exporting capabilities suggests that combinatorial approaches involving YadH and other transporters like MdtH (which has been shown to increase extracellular C3G levels by 110% ) may yield synergistic improvements in anthocyanin production.

What experimental designs can differentiate between direct and indirect effects of YadH on cellular phenotypes?

Differentiating between direct and indirect effects of YadH on cellular phenotypes requires sophisticated experimental designs that can establish causal relationships. Based on methodological literature, the most effective approaches include:

  • Parallel Design Experiments: This approach involves two parallel experiments - one observational study where both treatment and mediator vary naturally, and one interventional study where the mediator is manipulated experimentally . In the context of YadH research:

    • First experiment: Measure the relationship between YadH expression (treatment) and the ultimate phenotype

    • Second experiment: Artificially manipulate YadH expression levels and measure the outcomes

    • This design can identify the average natural indirect effects of YadH on phenotypes

  • Crossover Design Studies: In this approach, each experimental unit receives different treatments in sequential periods, serving as its own control . For YadH research:

    • First period: Units receive one treatment condition

    • Second period: Units receive the alternative treatment condition (with mediator values fixed from the first period)

    • This design controls for unit-specific confounding factors

  • Mediation Analysis: Statistical approaches that partition the total effect of a treatment into direct and indirect components:

    • Total effect = Direct effect + Indirect effect through YadH

    • Requires careful measurement of potential mediating variables

The consistency assumption is critical in these designs - that the manipulation of YadH itself does not directly affect the outcome in ways that differ from its natural variation . Researchers must also consider potential interactions between treatments and mediators, which can complicate interpretation.

These experimental approaches should be combined with molecular techniques that track specific YadH-dependent processes, such as lipid trafficking or substrate export, to establish mechanistic connections between YadH activity and observed phenotypes.

How does YadH function compare to other multidrug resistance transporters in E. coli?

YadH exists within a diverse landscape of multidrug resistance transporters in E. coli, each with distinct substrate preferences, transport mechanisms, and physiological roles. Comparative analysis reveals:

Table 4: Comparison of YadH with Other E. coli Multidrug Transporters

TransporterFamilyKey SubstratesFunctional RoleEfficiency in C3G Export
YadHABCC3G, phospholipidsAnthocyanin export, membrane lipid asymmetry15% increase in production
MdtHMFSC3G, other anthocyaninsAnthocyanin export110% increase in C3G level
AcrAB-TolCRNDAntibiotics, dyes, detergentsMajor multidrug efflux systemNot specifically characterized for C3G
EmrABMFSHydrophobic compoundsDrug and toxin resistanceNot specifically characterized for C3G
MacABABCMacrolide antibioticsAntibiotic resistanceNot specifically characterized for C3G

The distinct efficiency profiles suggest different evolutionary adaptations and molecular mechanisms. YadH's dual functionality in both small molecule transport and membrane lipid organization distinguishes it from transporters like MdtH, which appears more specialized for anthocyanin export with significantly higher efficiency .

The molecular basis for these functional differences likely relates to:

  • Structural features: Differences in substrate binding pockets and transport channels

  • Energy coupling: ABC transporters like YadH use ATP hydrolysis, while MFS transporters like MdtH utilize proton gradients

  • Protein partnerships: YadH's association with the Mla system indicates integration into larger functional networks

Understanding these comparative aspects can guide rational selection of transporters for specific biotechnological applications. For anthocyanin production, the superior performance of MdtH suggests it may be a more promising target than YadH , though YadH's contribution to membrane integrity may offer additional benefits in certain contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.