Recombinant Escherichia coli Inner membrane transport permease yhhJ (yhhJ)

Shipped with Ice Packs
In Stock

Description

Functional Insights

YhhJ is hypothesized to function as the membrane-spanning component of an ABC transporter complex (e.g., YbhFSR), potentially contributing to antibiotic resistance through efflux mechanisms . Key findings include:

  • Putative Role: Associates with ATP-binding components (e.g., YhiH/YhiI) to translocate substrates across the inner membrane .

  • Genetic Context: Located near yhiH and yhiI genes, forming a conserved operon .

  • Phenotypic Impact: Deletion mutants exhibit growth defects in rich media, suggesting a role in general physiology .

Production and Purification

Recombinant YhhJ is produced in heterologous systems, including E. coli, mammalian cells, and yeast . Standard protocols involve:

ParameterSpecification
Expression SystemE. coli (common), mammalian cells (e.g., HEK293), or yeast
Purity>85% (SDS-PAGE)
StorageLyophilized at -20°C/-80°C; reconstituted with 5–50% glycerol

Reconstitution Guidelines:

  • Centrifuge vials before opening to pellet contents .

  • Avoid repeated freeze-thaw cycles to prevent aggregation .

Research Applications

YhhJ is primarily used in:

  1. Membrane Protein Studies: As a model for ABC transporter structure-function analysis .

  2. Antibiotic Resistance Research: Investigating efflux mechanisms in Gram-negative bacteria .

  3. Biochemical Assays: Protein-protein interaction screens with partners like YhiH/YhiI .

Unresolved Questions and Future Directions

  • Substrate Specificity: The exact molecules transported by YhhJ remain unidentified .

  • Mechanistic Details: Whether ATP hydrolysis or proton motive force drives transport is unclear .

  • Structural Validation: High-resolution cryo-EM or crystallographic data are needed to confirm AlphaFold predictions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yhhJ; b3485; JW5677; Inner membrane transport permease YhhJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-374
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yhhJ
Target Protein Sequence
MRHLRNIFNLGIKELRSLLGDKAMLTLIVFSFTVSVYSSATVTPGSLNLAPIAIADMDQS QLSNRIVNSFYRPWFLPPEMITADEMDAGLDAGRYTFAINIPPNFQRDVLAGRQPDIQVN VDATRMSQAFTGNGYIQNIINGEVNSFVARYRDNSEPLVSLETRMRFNPNLDPAWFGGVM AIINNITMLAIVLTGSALIREREHGTVEHLLVMPITPFEIMMAKIWSMGLVVLVVSGLSL VLMVKGVLGVPIEGSIPLFMLGVALSLFATTSIGIFMGTIARSMPQLGLLVILVLLPLQM LSGGSTPRESMPQMVQDIMLTMPTTHFVSLAQAILYRGAGFEIVWPQFLTLMAIGGAFFT IALLRFRKTIGTMA
Uniprot No.

Target Background

Database Links
Protein Families
ABC-2 integral membrane protein family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the yhhJ permease compare structurally with other well-characterized bacterial inner membrane transporters?

While specific structural data for yhhJ is limited, comparison with other characterized inner membrane transporters provides valuable insights. Like many bacterial inner membrane transporters, yhhJ likely adopts a multi-pass transmembrane topology with alpha-helical domains spanning the membrane.

YhdP, another E. coli transporter, has been recently characterized using AlphaFold predictions and negative stain electron microscopy. It forms an elongated assembly of 60 β strands with a continuous hydrophobic groove approximately 250 Å in length, sufficient to span the bacterial cell envelope . In contrast, ABC transporters like YejABEF typically consist of two transmembrane domains and two nucleotide-binding domains .

Sequence analysis and topology prediction algorithms suggest yhhJ likely contains:

  • 6-12 transmembrane helices

  • Conserved sequence motifs characteristic of the Major Facilitator Superfamily (MFS)

  • Potential substrate binding sites within the transmembrane regions

Definitive structural characterization would require techniques such as X-ray crystallography, cryo-EM, or NMR spectroscopy applied specifically to purified yhhJ protein.

What are the recommended growth conditions for maximizing recombinant yhhJ expression in E. coli?

For maximizing yhhJ expression, a high-cell-density approach has proven highly effective for membrane proteins in E. coli. The following protocol is recommended:

ParameterRecommended ConditionNotes
Growth mediumTerrific Broth or Super BrothRich media supports higher cell density
Initial growth temperature37°CUntil reaching OD600 of 3-7
Pre-induction temperature20-25°CSwitch 1 hour before induction
Induction0.1-0.5 mM IPTGLower concentrations reduce toxicity
Post-induction temperature18-20°CSlows expression and improves folding
Post-induction time16-20 hoursExtended time for proper membrane integration
AerationHigh (>60% saturation)Crucial for high cell density cultures
Supplements0.5% glucose, 1 mM MgSO4Enhances membrane protein expression

This optimized protocol can achieve cell densities of OD600 10-20, resulting in 9- to 85-fold enhancement in protein yields compared to standard protocols . For isotopically labeled proteins (15N, 13C, 2H), modifications to the minimal media composition would be necessary while maintaining the high-density approach.

How can structural motifs in yhhJ be identified and correlated with specific transport functions?

Identifying structure-function relationships in yhhJ requires a multi-faceted approach combining computational prediction, targeted mutagenesis, and functional assays:

  • Computational analysis:

    • Perform multiple sequence alignment with functionally characterized transporters

    • Apply conservation analysis to identify potentially important residues

    • Use tools like AlphaFold to generate structural models

  • Targeted mutagenesis strategy:

    • Focus on conserved residues in predicted transmembrane domains

    • Create alanine scanning libraries across putative substrate binding regions

    • Introduce mutations in motifs associated with transport cycles (e.g., salt bridges, charge relay systems)

  • Functional correlation:

    • Establish transport assays using radiolabeled or fluorescent substrates

    • Measure kinetic parameters (Km, Vmax) for each mutant

    • Assess protein expression and membrane localization using Western blotting and fluorescence microscopy

The YhdP transporter provides an instructive example where molecular dynamics simulations revealed functionally essential helical regions at the N- and C-termini, with a critical amphipathic helix (P-helix) embedding within the outer leaflet of the inner membrane . Similar approaches could identify crucial structural elements in yhhJ.

What methodologies are most effective for determining the substrate specificity of yhhJ?

Determining substrate specificity for inner membrane transporters like yhhJ requires systematic investigation using multiple complementary approaches:

  • Genetic approaches:

    • Generate knockout strains (ΔyhhJ) and assess phenotypic changes

    • Perform complementation studies with yhhJ variants

    • Evaluate growth under various nutrient limitations

  • Transport assays:

    • Prepare inverted membrane vesicles containing overexpressed yhhJ

    • Screen potential substrates using:

      • Radioisotope uptake assays (3H or 14C-labeled compounds)

      • Fluorescence-based transport assays

      • Electrochemical gradient dissipation measurements

  • Binding studies:

    • Isothermal titration calorimetry with purified protein

    • Surface plasmon resonance with immobilized yhhJ

    • Thermal shift assays in presence of potential substrates

  • Comparative genomics:

    • Analyze yhhJ gene neighborhood across bacterial species

    • Identify co-regulated genes that may provide functional hints

    • Compare expression patterns under various growth conditions

The YejABEF transporter case study illustrates the power of this approach. Researchers identified its role in Microcin C uptake by screening a random transposon library for resistant mutants, which localized to the YejABEF locus . Subsequently, site-specific mutant analysis confirmed that all four components were required for transporter function.

What solubilization and purification strategies yield functional yhhJ protein for biochemical studies?

Obtaining pure, functional membrane proteins like yhhJ requires careful optimization of solubilization and purification conditions:

StageRecommended ApproachCritical Parameters
Membrane isolationDifferential ultracentrifugation40,000×g for 1h after cell lysis
Solubilization screeningTest panel of detergentsDDM, LMNG, DMNG at 1-2% (w/v)
Optimal solubilizationGentle mixing at 4°C1-3 hours with protease inhibitors
Affinity purificationIMAC for His-tagged constructsDetergent at CMC + 0.05% in all buffers
Secondary purificationSize exclusion chromatographyAssess monodispersity by dynamic light scattering
Stability assessmentThermal shift assaysTest various pH, salt, and additive conditions

The critical step is detergent selection, as it must effectively extract yhhJ from the membrane while maintaining its native fold and function. For challenging membrane proteins, newer amphipathic polymers like SMALPs (Styrene Maleic Acid Lipid Particles) can extract proteins with their surrounding lipid environment intact.

For functional studies, consider reconstituting purified yhhJ into proteoliposomes using methods such as:

  • Detergent removal by Bio-Beads or dialysis

  • Direct incorporation during liposome formation

  • Reconstitution into nanodiscs with membrane scaffold proteins

Quality control should include verification of proper folding using circular dichroism and assessment of function through substrate binding or transport assays .

How can heterologous expression systems be optimized to overcome toxicity issues when expressing yhhJ?

Expression of membrane transporters like yhhJ often presents toxicity challenges that can be addressed through systematic optimization:

  • Strain selection:

    • Use C41/C43(DE3) strains derived from BL21(DE3), specifically evolved to tolerate membrane protein overexpression

    • Consider Lemo21(DE3) which allows tunable expression through rhamnose-controlled T7 lysozyme levels

    • Test Rosetta strains if codon usage is an issue

  • Expression vector modifications:

    • Implement tightly regulated promoters with minimal leaky expression

    • Include a lacI or lacIq gene on the plasmid for tighter regulation

    • Consider using lower copy number plasmids (p15A origin instead of ColE1)

  • Expression conditions optimization:

    • Reduce culture temperature to 16-25°C during expression

    • Decrease inducer concentration (0.01-0.1 mM IPTG)

    • Add 0.5-1% glucose to culture medium to suppress basal expression

  • Protein engineering approaches:

    • Fuse yhhJ to periplasmic folding modulators like DsbC

    • Create truncated constructs or split proteins if full-length is toxic

    • Test fusion with stabilizing partners like GFP or MBP

The innovative vesicle-nucleating peptide tag system described in source represents a particularly promising approach for expressing toxic membrane proteins. This system exports multiple recombinant proteins in membrane-bound vesicles from E. coli, compartmentalizing proteins within a micro-environment that facilitates the production of otherwise challenging, toxic, or insoluble proteins .

What approaches are most effective for studying yhhJ-lipid interactions in the E. coli inner membrane?

Understanding how yhhJ interacts with membrane lipids is crucial for elucidating its function and regulation. Several complementary approaches can reveal these interactions:

  • Mass spectrometry-based approaches:

    • Native mass spectrometry of purified yhhJ to identify co-purifying lipids

    • Lipidomics analysis of lipids extracted from purified yhhJ

    • Hydrogen-deuterium exchange mass spectrometry to identify lipid-interacting regions

  • Biophysical techniques:

    • Fluorescence-based assays with environment-sensitive probes

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

    • Differential scanning calorimetry to measure thermodynamic parameters of protein-lipid interactions

  • Molecular dynamics simulations:

    • Coarse-grained simulations to observe spontaneous lipid interactions

    • All-atom simulations to characterize specific binding sites

    • Free energy calculations to quantify binding affinities

  • Functional assays with defined lipid compositions:

    • Reconstitution into liposomes with varying lipid compositions

    • Activity assays in presence of specific lipids

    • Competition assays with lipid analogs

The YhdP case study demonstrates the value of this approach. Molecular dynamics simulations showed that inner membrane lipids spontaneously enter the groove of YhdP, and in vivo crosslinking revealed phosphate-containing substrates captured along the length of the protein, providing direct evidence for phospholipid transport .

What are the best approaches for determining if yhhJ functions as part of a larger protein complex in the inner membrane?

Membrane transporters often function within larger complexes. To determine if yhhJ participates in such complexes:

  • Co-immunoprecipitation studies:

    • Generate antibodies against yhhJ or use epitope-tagged versions

    • Perform pull-downs under native conditions preserving protein-protein interactions

    • Identify interacting partners using mass spectrometry

  • Genetic interaction mapping:

    • Conduct synthetic genetic array analysis with yhhJ deletion

    • Identify genetic interactions suggesting functional relationships

    • Validate with targeted double knockouts and phenotypic analysis

  • In vivo cross-linking:

    • Apply membrane-permeable cross-linkers to intact cells

    • Use formaldehyde or photo-activatable cross-linkers

    • Identify cross-linked complexes by size shift and mass spectrometry

  • Blue Native PAGE:

    • Solubilize membranes under mild conditions

    • Separate native complexes by Blue Native PAGE

    • Identify complex components by 2D SDS-PAGE or mass spectrometry

  • Förster Resonance Energy Transfer (FRET):

    • Create fluorescent protein fusions (yhhJ-CFP, potential partner-YFP)

    • Measure FRET efficiency in living cells

    • Map interaction interfaces using truncated constructs

The study of YejABEF transporter provides an instructive example, where researchers established that all four components (YejA, YejB, YejE, and YejF) are required for McC uptake function through systematic analysis of site-specific mutants . Similar approaches could identify potential protein partners of yhhJ.

How can transcriptional regulation of yhhJ be characterized under various environmental conditions?

Understanding the transcriptional regulation of yhhJ provides insights into its physiological role. To characterize this regulation:

  • Promoter analysis:

    • Identify the yhhJ promoter region through bioinformatic analysis

    • Create transcriptional fusions with reporter genes (lacZ, GFP, luciferase)

    • Measure promoter activity under different growth conditions

  • Transcription factor identification:

    • Perform ChIP-seq to identify proteins bound to the yhhJ promoter

    • Use DNase I footprinting to map protected regions

    • Conduct EMSA with purified transcription factors to confirm direct binding

  • Global transcriptional profiling:

    • Compare RNA-seq data across diverse growth conditions

    • Identify conditions that induce or repress yhhJ expression

    • Cluster with co-regulated genes to identify regulons

  • Single-cell analysis:

    • Use GFP reporter fusions to assess cell-to-cell variability

    • Apply microfluidics to monitor expression dynamics

    • Correlate expression with physiological parameters

The YdeO regulon study provides a methodological template. Researchers combined ChIP-chip to identify genome-wide binding sites with RT-qPCR, EMSA, DNaseI-footprinting, and reporter assays to confirm direct regulatory relationships . This integrative approach revealed that YdeO regulates stress-response transcription factors and enzymes for anaerobic respiration.

ConditionTechniqueExpected Outcome
Nutrient limitationRNA-seq, RT-qPCRQuantitative expression changes
Stress exposureReporter fusion assaysTemporal expression dynamics
Growth phaseChIP-seqIdentification of regulators
Genetic perturbationsTranscriptome analysisRegulatory network mapping

How might CRISPR-Cas9 genome editing be utilized to study yhhJ function in diverse E. coli strains?

CRISPR-Cas9 offers powerful capabilities for precise genetic manipulation to study yhhJ function:

  • Strain-specific gene knockout:

    • Design sgRNAs targeting conserved regions of yhhJ

    • Create clean deletions without antibiotic markers

    • Compare phenotypic effects across pathogenic and non-pathogenic strains

  • Endogenous tagging:

    • Insert epitope tags or fluorescent proteins at the native locus

    • Maintain natural expression patterns and regulation

    • Monitor localization and expression in real-time

  • Point mutation generation:

    • Introduce specific mutations to test structure-function hypotheses

    • Create libraries of variants to screen for phenotypes

    • Modify regulatory sequences to alter expression patterns

  • CRISPRi applications:

    • Use catalytically inactive Cas9 (dCas9) for targeted repression

    • Create inducible knockdown systems for essential genes

    • Generate graded expression levels to assess threshold effects

  • Multi-gene editing:

    • Target yhhJ along with potential functional partners

    • Create combinatorial mutation libraries

    • Assess synthetic genetic interactions

This approach would comply with NIH Guidelines since most common laboratory E. coli strains are exempt from stringent regulation as long as appropriate biosafety practices are maintained . When working with non-exempt strains or introducing DNA from non-exempt organisms, proper IBC review and approval would be required.

What high-throughput approaches could reveal the physiological role of yhhJ in bacterial stress response?

To comprehensively understand yhhJ's role in stress response:

  • Transposon sequencing (Tn-seq):

    • Create saturating transposon libraries in wild-type and ΔyhhJ backgrounds

    • Challenge with various stressors (antibiotics, pH, osmotic stress)

    • Identify genetic interactions by comparing fitness profiles

  • Metabolomics profiling:

    • Compare metabolite levels between wild-type and ΔyhhJ strains

    • Analyze changes under stress conditions

    • Identify metabolic pathways affected by yhhJ deletion

  • Proteomics approaches:

    • Quantitative proteomics using SILAC or TMT labeling

    • Phosphoproteomics to identify signaling pathways

    • Protein-protein interaction networks using BioID or APEX proximity labeling

  • Phenotypic microarrays:

    • Test growth across hundreds of conditions simultaneously

    • Identify specific nutrients or stressors affected by yhhJ activity

    • Compare with other transporter mutants to identify functional overlaps

  • Single-cell analysis:

    • Microfluidic devices for long-term monitoring under changing conditions

    • Correlate gene expression with cellular physiology

    • Identify subpopulations with distinct responses

The YhdP study demonstrated the value of phenotypic assays, where researchers utilized vancomycin and SDS+EDTA sensitivity assays to evaluate the functionality of YhdP mutants and identify essential structural regions . Similar approaches could be applied to characterize yhhJ's role in various stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.