Recombinant Escherichia coli Lead, cadmium, zinc and mercury-transporting ATPase (zntA)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Classification

ZntA belongs to the PIB-type ATPase family, characterized by:

  • Eight transmembrane helices with a conserved CPC motif in transmembrane domain 6, critical for metal binding .

  • Intracellular domains: Actuator (A), phosphorylation (P), and nucleotide-binding (N) domains that hydrolyze ATP .

  • Histidine-rich regions in some homologs (e.g., Pseudomonas CadA), though ZntA lacks these extensions .

Structural Insights from SsZntA (Homolog):

FeatureDescription
Metal-binding siteHigh-affinity intramembranous site for Zn²⁺, coordinated by Cys392/394/496 .
Extracellular pathwayFormed by rearrangements in transmembrane helices during the E2P-E2 transition .
Conserved motifsTGE loop (A-domain), DKTGT (P-domain), and GDGxNDxP (N-domain) .

Functional Roles in Metal Resistance

ZntA confers resistance by actively exporting metals via ATP hydrolysis:

  • Substrate specificity: Zn²⁺ > Cd²⁺ ≈ Pb²⁺ > Hg²⁺ .

    • No significant activity with Cu²⁺ or Ag⁺ .

  • Regulation: Controlled by ZntR, a MerR-family transcription factor activated by Zn²⁺/Cd²⁺ .

  • Metal induction:

    • zntA expression is upregulated by Zn²⁺ (50–500 µM) .

    • Cadmium and lead also induce zntA transcription, but to a lesser extent .

Phenotypic Effects of zntA Knockout:

ConditionPhenotypeCitation
Zn²⁺/Cd²⁺ exposureHypersensitivity (MIC reduced by ~90%)
Pb²⁺ exposureModerate sensitivity
Fe-S cluster biogenesisImpaired due to zinc toxicity

Biochemical Characterization

  • ATPase activity:

    • Activated by Zn²⁺, Cd²⁺, Pb²⁺, and Hg²⁺ (Km for Zn²⁺: ~2 µM) .

    • Inhibited by vanadate (IC₅₀: 10 µM) .

  • Phosphorylation:

    • Forms acyl-phosphate intermediates (MW: ~90 kDa monomer, 190 kDa dimer) .

    • Mutations (e.g., His475Gln, Glu470Ala) reduce ATPase activity by 60–70% .

Metal Activation Profiles:

Metal IonRelative ATPase Activity (%)Phosphorylation Efficiency
Zn²⁺100High
Cd²⁺85Moderate
Pb²⁺75Low
Hg²⁺60Minimal
Data derived from .

Applications in Environmental and Biotechnological Contexts

  • Bioremediation:

    • Environmental E. coli strains overexpressing ZntA show enhanced Zn²⁺/Cd²⁺ accumulation (e.g., 0.85–1.69 Zn atoms per protein monomer) .

    • Co-presence of Pb²⁺ inhibits Zn²⁺ uptake, suggesting competitive binding .

  • Zinc toxicity mitigation:

    • ZntA prevents zinc-induced iron-sulfur cluster damage by reducing cytosolic Zn²⁺ levels .

Comparative Analysis with Homologs

FeatureZntA (E. coli)CadA (Staphylococcus)CzcA (Alcaligenes)
Metal specificityZn²⁺, Cd²⁺, Pb²⁺, Hg²⁺Cd²⁺Zn²⁺, Cd²⁺, Co²⁺
Energy couplingATP hydrolysisATP hydrolysisProton antiport
RegulatorZntR (MerR family)CadC (ArsR family)CzcR (Two-component)
Data from .

Key Mutational Studies

  • His475Gln mutation: Disrupts ATP binding, stabilizing a dephosphorylated state .

  • Glu470Ala mutation: Favors E2 conformational state, reducing Zn²⁺ transport efficiency .

  • Cysteine substitutions: Eliminate Zn²⁺ binding in IscU/IscA, exacerbating metal toxicity .

Biotechnological Potential

  • Engineered strains: zntA-overexpressing E. coli used for biosensing and bioremediation of contaminated water .

  • Chimeric proteins: Fusion with ATP7B (human Cu⁺-ATPase) retains Zn²⁺/Cd²⁺ specificity, confirming transmembrane domains dictate substrate selection .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery timelines.
Note: All of our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing it for you.
Synonyms
zntA; yhhO; b3469; JW3434; Zinc/cadmium/lead-transporting P-type ATPase; Pb(II/Cd(II/Zn(II-translocating ATPase; Zn(2+/Cd(2+/Pb(2+ export ATPase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-732
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
zntA
Target Protein Sequence
MSTPDNHGKKAPQFAAFKPLTTVQNANDCCCDGACSSTPTLSENVSGTRYSWKVSGMDCA ACARKVENAVRQLAGVNQVQVLFATEKLVVDADNDIRAQVESALQKAGYSLRDEQAAEEP QASRLKENLPLITLIVMMAISWGLEQFNHPFGQLAFIATTLVGLYPIARQALRLIKSGSY FAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARQGVSALMALKPETAT RLRKGEREEVAINSLRPGDVIEVAAGGRLPADGKLLSPFASFDESALTGESIPVERATGD KVPAGATSVDRLVTLEVLSEPGASAIDRILKLIEEAEERRAPIERFIDRFSRIYTPAIMA VALLVTLVPPLLFAASWQEWIYKGLTLLLIGCPCALVISTPAAITSGLAAAARRGALIKG GAALEQLGRVTQVAFDKTGTLTVGKPRVTAIHPATGISESELLTLAAAVEQGATHPLAQA IVREAQVAELAIPTAESQRALVGSGIEAQVNGERVLICAAGKHPADAFTGLINELESAGQ TVVLVVRNDDVLGVIALQDTLRADAATAISELNALGVKGVILTGDNPRAAAAIAGELGLE FKAGLLPEDKVKAVTELNQHAPLAMVGDGINDAPAMKAAAIGIAMGSGTDVALETADAAL THNHLRGLVQMIELARATHANIRQNITIALGLKGIFLVTTLLGMTGLWLAVLADTGATVL VTANALRLLRRR
Uniprot No.

Target Background

Function
The protein confers resistance to zinc, cadmium, and lead. It couples the hydrolysis of ATP with the export of zinc, cadmium, or lead, exhibiting highest activity when the metals are present as metal-thiolate complexes. This protein can also bind nickel, copper, cobalt, and mercury.
Gene References Into Functions
  1. The selectivity in ZntA likely arises from differences in metal-binding geometry, which in turn produce distinct structural responses. PMID: 16411752
  2. The residues D(693) and D(714) are functionally crucial and appear to contribute to the metal specificity of ZntA, most likely by forming part of the metal-binding site composed of the CPC motif. PMID: 16890908
Database Links
Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of zntA in Escherichia coli?

ZntA functions as a critical P-type ATPase that exports zinc and other heavy metals from the bacterial cytoplasm, playing a central role in zinc homeostasis. When examining the function of zntA, it's important to understand that it works as part of a coordinated system with other transporters like ZitB to maintain optimal intracellular zinc concentrations. Based on in vivo studies, ZntA serves as a secondary response mechanism that is upregulated after zinc shock, while ZitB provides the first-line defense against toxic zinc influx .

For methodological approaches to studying this function, researchers should consider:

  • Creating knockout strains (ΔzntA) to observe changes in zinc tolerance

  • Monitoring free zinc concentration dynamics after zinc shock in wild-type versus knockout strains

  • Measuring zntA mRNA levels in response to varying zinc concentrations

How is zntA expression regulated in bacterial systems?

ZntA is primarily regulated by ZntR, a MerR-like transcription factor that is activated by zinc. The regulatory mechanism involves a zinc-dependent activation process where the apo-ZntR dimer binds to the zntA promoter and weakly represses transcription. Upon binding zinc ions (1-2 per monomer depending on reducing potential), ZntR undergoes conformational changes that induce DNA unwinding, enhancing RNA polymerase binding to the -35 and -10 positions of the promoter to initiate transcription .

To effectively study this regulation experimentally:

  • Create reporter constructs using zntA promoter-lacZ fusions

  • Perform in vitro transcription assays with purified ZntR and varying zinc concentrations

  • Use chromatin immunoprecipitation to assess ZntR binding to the zntA promoter under different conditions

What are the kinetic properties of ZntA-mediated metal transport?

The ATP-driven zinc transport mediated by ZntA exhibits an apparent Km of 9 μM, which is significantly higher than the estimated free zinc concentration in healthy bacterial cells. This suggests that ZntA is optimized to function during conditions of zinc excess. In vitro studies indicate that thiolate-bound Cd²⁺ or Zn²⁺ are the most effective substrates for ZntA-mediated transport .

To accurately determine metal transport kinetics:

  • Use inverted membrane vesicles expressing recombinant ZntA

  • Measure ATP hydrolysis rates in response to various metal substrates

  • Employ radioisotope uptake/efflux assays with ⁶⁵Zn and other relevant metal isotopes

How does ZntA interact with other metal transport systems?

ZntA functions in coordination with other transporters like ZitB, which belongs to the Cation Diffusion Facilitator (CDF) family. While deletion of zitB alone does not significantly affect cell survival under high zinc conditions, the double deletion of zitB and zntA renders cells more sensitive to zinc stress compared to a single zntA deletion . This indicates complementary but distinct roles for these transporters.

TransporterFamilyTransport MechanismKinetic PropertiesRole in Metal Homeostasis
ZntAP-type ATPaseATP-driven exportKm ≈ 9 μMSecondary response, efficient lowering of free zinc
ZitBCDF FamilyH⁺/Zn²⁺ antiport (1:1)Km ≈ 105 μMConstitutive first-line defense
MdtABCRND FamilyProton-dependentNot specified in dataComplementary zinc detoxification
MdtDMFS FamilyProton-dependentNot specified in dataComplementary zinc detoxification

What experimental approaches are most effective for studying zntA-mediated metal ion selectivity?

The study of metal selectivity in zntA requires sophisticated methodological approaches that can distinguish between different metal ions and their binding affinities. Based on current research practices, the following experimental design is recommended:

  • Site-directed mutagenesis of metal-binding residues in recombinant zntA

  • Metal competition assays using purified protein with multiple metals present

  • Isothermal titration calorimetry (ITC) to determine binding constants for different metals

  • X-ray absorption spectroscopy to analyze coordination chemistry of metal-binding sites

When conducting these experiments, it's crucial to control metal speciation by using appropriate chelators like TPEN to establish defined free metal ion concentrations. In vitro measurements indicate that ZntR has an apparent femtomolar affinity for both zinc binding and zinc-dependent activation of transcription in TPEN-chelated zinc buffers .

How can researchers accurately measure intracellular free zinc concentration changes in response to zntA activity?

Accurate measurement of intracellular free zinc concentrations presents significant technical challenges due to the extremely low concentrations involved (picomolar to nanomolar range). A methodological approach that combines multiple techniques provides the most reliable data:

  • Genetically encoded fluorescent zinc sensors (e.g., FRET-based sensors)

  • Zinc-specific fluorescent dyes with appropriate calibration

  • Real-time monitoring systems coupled with genetic manipulation

The experimental design should include:

  • Comparison between wild-type, ΔzntA, and ΔzitB strains

  • Zinc shock experiments with time-course measurements

  • Correlation of free zinc levels with zntA mRNA expression

Based on published data, the free zinc concentration rises more rapidly after zinc shock in ΔzitB strains compared to wild-type cells, while ΔzntA strains show prolonged accumulation of free zinc . This suggests differential roles in zinc homeostasis timing.

What are the most effective strategies for analyzing the structure-function relationship of ZntA?

Understanding the structure-function relationship of ZntA requires integrating structural biology approaches with functional assays:

  • Cryo-electron microscopy or X-ray crystallography of ZntA in different conformational states

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Molecular dynamics simulations to analyze metal transport pathways

  • Functional validation using transport assays with structure-based mutants

When designing these experiments, researchers should consider:

  • The membrane environment's effect on protein structure and function

  • The importance of capturing multiple conformational states in the transport cycle

  • The potential for metal-dependent structural changes

How can transcriptomic and proteomic approaches be integrated to study zntA regulation?

Integration of multi-omics approaches provides comprehensive insights into zntA regulation:

TechniqueApplicationData Analysis ApproachKey Considerations
RNA-SeqGlobal transcriptional response to zinc stressDifferential expression analysisTime-course design is crucial
ChIP-SeqGenome-wide ZntR binding sitesPeak calling and motif analysisAntibody specificity for ZntR
ProteomicsZinc-dependent protein expression changesQuantitative comparison between conditionsSample preparation must preserve metal-protein interactions
MetabolomicsChanges in zinc-dependent metabolic pathwaysPathway enrichment analysisRapid quenching to prevent metabolite degradation

To effectively integrate these datasets:

  • Use time-resolved sampling to capture dynamic responses

  • Apply network analysis to identify regulatory hubs

  • Validate key findings with targeted experimental approaches

  • Develop computational models that can predict system behavior under different conditions

What approaches are recommended for studying the zinc-dependent ZntR-mediated activation of zntA transcription?

The zinc-dependent activation of zntA transcription by ZntR involves complex molecular interactions that can be studied through:

  • In vitro transcription assays with purified components

  • DNA footprinting to identify precise ZntR binding regions

  • Single-molecule techniques to observe ZntR-induced DNA conformational changes

  • Reporter gene assays in vivo under controlled zinc conditions

When designing these experiments, researchers should consider that ZntR-mediated transcription of zntA exhibits an apparent K₁/₂ for zinc activation in the nanomolar range in vivo . Additionally, the formation of the Zn-ZntR-DNA complex reduces degradation of ZntR catalyzed by E. coli proteases, adding another regulatory layer to consider .

What control groups are essential when studying zntA function?

When designing experiments to study zntA function, appropriate controls are critical for valid interpretation:

  • Wild-type E. coli strain (positive control)

  • ΔzntA knockout strain

  • ΔzitB knockout strain (to understand complementary systems)

  • Double knockout ΔzntA/ΔzitB strain

  • Complementation strain (ΔzntA with plasmid-expressed zntA)

  • Site-directed mutants of critical residues

Random assignment of bacterial cultures to experimental groups is essential for statistical validity . Additionally, researchers should consider including metal chelation controls to establish baseline conditions without interference from trace metals in media.

How should researchers design zinc shock experiments to study zntA response dynamics?

Zinc shock experiments should be carefully designed to capture the temporal dynamics of zntA response:

  • Define clear experimental hypotheses about the role of zntA

  • Select appropriate zinc concentrations based on preliminary dose-response studies

  • Include time-course measurements (immediate, short-term, and long-term responses)

  • Monitor multiple parameters simultaneously (free zinc, total zinc, zntA expression, growth rate)

A well-designed experiment would include:

  • Pre-measurement of baseline conditions

  • Synchronized zinc addition to all experimental cultures

  • Rapid sampling at defined intervals

  • Appropriate statistical analysis of time-series data

What statistical approaches are recommended for analyzing zntA expression and function data?

When analyzing data related to zntA expression and function, appropriate statistical methods are crucial:

  • For time-course experiments: repeated measures ANOVA or mixed-effects models

  • For dose-response relationships: non-linear regression models

  • For comparing multiple strains/conditions: factorial ANOVA with post-hoc tests

  • For correlating multiple parameters: multivariate analysis techniques

Sample size determination should be based on power analysis to ensure sufficient statistical power to detect biologically meaningful differences . Researchers should also be transparent about data transformations and outlier handling.

How can researchers address inconsistent results in zntA expression studies?

Inconsistent results in zntA expression studies may arise from several factors:

  • Trace metal contamination in media or water

  • Variability in bacterial growth phases

  • Genetic instability in recombinant strains

  • Technical variations in RNA extraction or quantification

Methodological solutions include:

  • Using metal-defined media with chelex treatment

  • Synchronizing cultures to the same growth phase

  • Verifying genetic stability through sequencing

  • Including internal controls for normalization

  • Employing standardized protocols with positive controls

What are common pitfalls in interpreting metal transport data for zntA?

Interpreting metal transport data for zntA requires careful consideration of several potential pitfalls:

  • Distinguishing between free and bound metal ions

  • Accounting for metal speciation in different buffer conditions

  • Considering the contribution of other transport systems

  • Recognizing the limitations of in vitro versus in vivo measurements

To address these challenges:

  • Use multiple complementary approaches to measure transport

  • Include appropriate controls (e.g., ATPase-deficient mutants)

  • Consider the thermodynamic and kinetic aspects of metal binding

  • Validate findings across different experimental systems

How can researchers reconcile conflicting data about zntA substrate specificity?

When faced with conflicting data regarding zntA substrate specificity:

  • Carefully evaluate experimental conditions across studies (pH, temperature, metal speciation)

  • Consider genetic backgrounds and potential compensatory mechanisms

  • Assess the sensitivity and specificity of detection methods

  • Examine post-translational modifications that might affect substrate binding

A systematic approach to resolving conflicts includes:

  • Direct comparative studies under standardized conditions

  • Construction of chimeric proteins to identify specificity-determining regions

  • Computational modeling of substrate binding and transport

What emerging technologies hold promise for advancing zntA research?

Several cutting-edge technologies show potential for transforming zntA research:

  • Cryo-EM for high-resolution structural determination of membrane transport complexes

  • Single-cell metal imaging techniques for spatial resolution of metal distribution

  • CRISPR-Cas9 genome editing for precise genetic manipulation

  • Microfluidic systems for controlled environmental perturbations and real-time monitoring

  • Synthetic biology approaches to create engineered regulatory circuits

These technologies can help address fundamental questions about zntA function, regulation, and interaction with other cellular components in metal homeostasis networks.

How might systems biology approaches enhance our understanding of zntA in the broader context of metal homeostasis?

Systems biology offers powerful frameworks for understanding zntA within the broader metal homeostasis network:

  • Mathematical modeling of metal flux through multiple transporters

  • Network analysis to identify regulatory hubs and feedback mechanisms

  • Integration of multi-omics data to build comprehensive models

  • Flux balance analysis to quantify the contribution of different transport systems

By adopting these approaches, researchers can move beyond studying zntA in isolation and begin to understand its role in maintaining metal homeostasis under diverse environmental conditions and stresses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.