Recombinant Escherichia coli Leader peptidase pppA (pppA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli Leader Peptidase pppA (pppA)

Recombinant E. coli leader peptidase pppA (pppA) is a type IV prepilin peptidase critical for processing bacterial pilin and pseudopilin precursors. This enzyme is encoded by the pppA gene (synonyms: yghH, b2972, JW2939) and belongs to the family of aspartic acid peptidases . Its primary function involves cleaving N-terminal leader peptides from prepilin proteins, enabling their assembly into functional pili or secretion system components . The recombinant form of pppA is His-tagged, spans residues 1–269 (full-length), and is expressed in E. coli for research applications .

Substrate Specificity

pppA processes prepilin precursors with small residues at positions -1 and -3 relative to the cleavage site. For example, PpdD (a type IV pilin in E. coli K-12) requires pppA for maturation . The enzyme exhibits temperature-dependent activity, with higher processing efficiency at 37°C compared to 30°C .

Type IV Pilus Biogenesis

pppA is essential for assembling type IV pili in E. coli. It cleaves the leader peptide of PpdD, a major pilin subunit, enabling its incorporation into pilus fibers . Mutational studies show that pppA deficiency results in impaired pilus formation, as observed in E. coli K-12 strains lacking functional pppA .

Role in Secretion Systems

pppA is critical for the T2SSβ (type II secretion system β) in enterotoxigenic E. coli (ETEC). It processes pseudopilin precursors required for the assembly of the GspDβ secretin multimer, which facilitates toxin secretion . Deletion of pppA abolishes LT (heat-labile toxin) secretion, highlighting its role in virulence .

Expression and Purification

Recombinant pppA is produced in E. coli as a His-tagged fusion protein and purified via nickel-affinity chromatography. Key specifications include:

ParameterValueSource
Host strainE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
Storage bufferTris/PBS with 6% trehalose, pH 8.0

Research Applications

  • Structural studies: Elucidating prepilin peptidase mechanisms.

  • Vaccine development: Targeting pppA to disrupt bacterial secretion systems.

  • Biotechnology: Engineering pppA for enhanced protein processing in E. coli systems .

Temperature-Dependent Activity

In E. coli K-12, pppA activity is low at 30°C but 50% active at 37°C. Exogenous prepilin peptidases (e.g., PulO, PilD) fully process PpdD, indicating pppA’s role in temperature-regulated pilus assembly .

Essential Role in T2SSβ

Deletion of pppA in ETEC prevents GspDβ secretin multimerization, leading to:

  1. Accumulation of monomeric GspDβ in the inner membrane.

  2. Loss of LT secretion, a critical virulence trait .

Evolutionary Conservation

While E. coli K-12 lacks functional type IV pili, the presence of pppA and related genes suggests evolutionary retention of piliation machinery for potential niche-specific functions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
pppA; yghH; b2972; JW2939; Prepilin peptidase PppA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
pppA
Target Protein Sequence
MLFDVFQQYPTAMPVLATVGGLIIGSFLNVVIWRYPIMLRQQMAEFHGEMSSAQSKISLA LPRSHCPHCQQTIRIRDNIPLFSWLMLKGRCRDCQAKISKRYPLVELLTALAFLLASLVW PESGWGLAVMILSAWLIAASVIDLDHQWLPDVFTQGVLWTGLIAAWAQQSPLTLQDAVTG VLVGFITFYSLRWIAGIVLRKEALGMGDVLLFAALGGWVGALSLPNVALIASCCGLIYAV ITKRGSTTLPFGPCLSLGGIATLYLQALF
Uniprot No.

Target Background

Function
A pre-pilin peptidase involved in a type II secretion system (T2SS, formerly general secretion pathway, GSP) for the export of folded proteins across the outer membrane.
Database Links
Protein Families
Peptidase A24 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the difference between Leader Peptidase and Signal Peptide Peptidase A (SppA) in E. coli?

    Leader peptidase (also known as signal peptidase) is responsible for the initial cleavage of signal peptides from precursor proteins during their insertion into membranes. It recognizes and cleaves the junction between the signal peptide and the mature protein. In contrast, Signal Peptide Peptidase A (SppA) acts downstream in the process, degrading the cleaved signal peptides after they have been removed from exported proteins by signal peptidase processing. Both enzymes are essential for proper protein export and membrane biogenesis in E. coli. While leader peptidase prevents accumulation of unprocessed precursors, SppA ensures that the cleaved signal peptides do not accumulate in the membrane, which could potentially disrupt membrane integrity .

  • Where is Leader Peptidase located in E. coli cells?

    Leader peptidase exhibits a unique distribution pattern in E. coli cells. Research has demonstrated that leader peptidase is found in equal abundance in both the inner and outer membranes of E. coli. This dual localization is particularly noteworthy as leader peptidase is the only known enzyme with this distribution pattern in E. coli, which may reflect its critical role in membrane biogenesis. Experimental verification of this distribution has been conducted using various biochemical techniques including ion exchange chromatography and nondenaturing gel electrophoresis, which confirmed that the enzyme's properties are identical in both membrane locations. The enzyme from each membrane fraction accurately cleaves procoat (the precursor of the major coat protein of bacteriophage M13) to mature M13 coat protein with identical salt, pH, and Mg²⁺ optima, as well as inhibitor sensitivities .

  • What is the membrane topology of SppA in E. coli?

    The membrane topology of E. coli SppA has been a subject of significant research interest. Although many topology prediction programs suggested that SppA spans the membrane three times, experimental evidence using alkaline phosphatase fusion experiments has established that SppA has only one transmembrane segment. The C-terminal domain, which contains the protease activity, protrudes into the periplasmic space, while the N-terminal domain remains in the cytoplasm. This topology is functionally significant as it positions the protease domain to access and degrade signal peptides that have been cleaved from exported proteins in the periplasmic space. The single-spanning nature of SppA differs from the topology of some other membrane proteases and provides important context for understanding how it interacts with its substrates .

  • How is SppA classified in protease databases?

    E. coli SppA protease has been classified in the S49 family of proteases in the MEROPS protease database, specifically to the S49.001 subfamily. This classification groups SppA with other signal peptide peptidases that share certain structural and functional features. The S49 family is further divided into subfamilies based on domain structure. The S49.001 subfamily, like S49.004, contains both a carboxyl-terminal protease domain (which is conserved across all S49 family members) and an amino-terminal domain. Other subfamily members (S49.002, S49.003, S49.005, and S49.006) lack this amino-terminal domain. These other groups include the sohB peptidase, protein C, protein 1510-N, and archaeal signal peptide peptidase, respectively. This classification system helps researchers understand the evolutionary relationships between different peptidases and can provide insights into potential functional mechanisms based on homology .

Advanced Research Questions

  • What catalytic mechanism does E. coli SppA employ and what are the key residues involved?

    E. coli SppA employs an unusual catalytic mechanism that differs from typical serine proteases. Site-directed mutagenesis studies of all conserved serines in the carboxyl-terminal domain revealed that only Serine 409 is essential for enzymatic activity. This was confirmed through inhibition studies with the serine hydrolase inhibitor FP-biotin, which covalently modifies wild-type SppA but fails to label the S409A mutant.

    Remarkably, E. coli SppA lacks the traditional catalytic triad found in many serine proteases. Extensive mutagenesis studies demonstrated that none of the lysines or histidine residues in the carboxyl-terminal protease domain is critical for activity, suggesting this domain lacks the general base residue typically required for proteolysis. Instead, research identified a conserved lysine (K209) in the N-terminal domain that is essential for activity and important for activation of S409.

    Based on these findings, E. coli SppA appears to function as a Ser-Lys dyad protease, with the catalytic lysine recruited from the amino-terminal domain—a domain that is not present in most known SppA sequences. This mechanism distinguishes E. coli SppA from archaeal SppA from T. kodakaraensis, which contains only the C-terminal protease domain but uses Ser162 and Lys214 for catalysis, both within that domain .

  • What experimental approaches are most effective for studying SppA active site residues?

    Research on SppA active site residues employs several complementary experimental approaches:

    1. Site-directed mutagenesis: Systematically substituting conserved residues (particularly serines, lysines, and histidines) with alanine to identify those critical for enzymatic activity. This approach successfully identified Ser409 and Lys209 as essential residues in E. coli SppA.

    2. Activity assays with natural substrates: Testing the ability of mutant variants to cleave natural signal peptide substrates to verify the functional importance of specific residues.

    3. Chemical modification with specific inhibitors: Using serine hydrolase inhibitors like FP-biotin that covalently modify active site serine residues. The wild-type enzyme becomes labeled, while mutants with substitutions at the catalytic serine do not, confirming the identity of the active site residue.

    4. Alkaline phosphatase fusion experiments: This approach helps determine membrane topology by fusing alkaline phosphatase at different positions within the protein and measuring enzymatic activity, which differs depending on whether the fusion is in the cytoplasm or periplasm.

    5. Comparative analysis across species: Comparing critical residues in SppA proteins from different organisms can help identify conserved catalytic mechanisms or species-specific adaptations .

  • How can recombinant protein yields in the E. coli periplasm be optimized using different signal peptides?

    Optimizing recombinant protein yields in the E. coli periplasm requires a combinatorial approach that considers both signal peptide selection and protein production rates. Research has shown that different signal peptides can dramatically affect periplasmic protein yields, and this effect is highly protein-specific.

    A systematic optimization approach involves:

    1. Signal peptide screening: Testing multiple signal peptides (such as those from DsbA, OmpA, PhoA, and Hbp autotransporter) fused to the target protein.

    2. Production rate tuning: Using titratable promoters (such as the rhamnose promoter system) to control protein production rates, as excessive production can overwhelm the secretion machinery.

    3. Temporal analysis: Monitoring production over time to identify optimal harvest points.

    4. Biomass normalization: Analyzing yields with equal amounts of biomass to accurately compare different conditions.

    Signal PeptideAdvantagesBest Applications
    DsbAEfficient for many targetsProteins requiring disulfide formation
    OmpARobust translocationSmaller proteins
    PhoAContains mature domain targeting signalsProteins with similar targeting signals
    HbpGood for larger proteinsProteins requiring post-translational translocation

    Research has demonstrated that certain signal peptide-protein combinations work particularly well because of compatibility between the signal peptide and mature domain targeting signals in the target protein. For example, PhoA signal peptide was effective for producing scFv BL1 but ineffective for human growth hormone (hGH) production. This difference was attributed to the presence of mature domain targeting signals in BL1 that could be identified using the MatureP predictor, while such signals were absent in hGH .

  • What strategies can be employed to enhance secretory protein translocation efficiency in E. coli?

    Enhancing secretory protein translocation efficiency in E. coli involves addressing several potential bottlenecks:

    1. Signal peptide optimization: Different signal peptides direct proteins to different translocation pathways (co-translational vs. post-translational). Matching the signal peptide to the appropriate pathway for a specific protein can significantly improve translocation efficiency.

    2. Controlling production rates: Using tunable promoter systems (such as rhamnose-inducible promoters) to prevent overwhelming the secretion machinery. Lower induction levels often yield better periplasmic production by allowing the secretion machinery to function optimally.

    3. Strain engineering: Utilizing strains with enhanced secretion capacity, such as those overexpressing components of the Sec translocon or with modified rhamnose utilization pathways.

    4. Signal peptide-target protein compatibility: Considering the interaction between signal peptides and the mature domain of the target protein. Some target proteins contain mature domain targeting signals that work better with specific signal peptides.

    5. Optimization of culture conditions: Adjusting temperature, media composition, and induction timing to support optimal protein translocation.

    6. Co-expression of chaperones: Introducing periplasmic chaperones to assist with protein folding after translocation.

    Research has shown that these approaches must be used in combination and that optimal conditions must be determined empirically for each target protein. The bottlenecks associated with targeting across the cytoplasmic membrane can substantially limit periplasmic yields, making optimization strategies crucial for efficient recombinant protein production .

  • How do mutations in key residues affect SppA activity and inhibitor binding?

    Site-directed mutagenesis studies on E. coli SppA have revealed specific effects of mutations on both enzymatic activity and inhibitor binding:

    ResidueMutationEffect on ActivityEffect on Inhibitor Binding
    Ser409S409AComplete loss of activityNo binding to FP-biotin
    Lys209K209AComplete loss of activityReduced S409 reactivity toward FP-biotin
    Other Ser residuesSer→AlaNo significant effectNormal binding to FP-biotin
    His residues in C-terminal domainHis→AlaNo significant effectNormal binding to FP-biotin
    Lys residues in C-terminal domainLys→AlaNo significant effectNormal binding to FP-biotin

    These results demonstrate that Ser409 is the active site nucleophile directly involved in catalysis, as its mutation prevents both enzymatic activity and covalent modification by the serine hydrolase inhibitor FP-biotin. The critical role of Lys209 from the N-terminal domain suggests it functions as the general base in the catalytic mechanism, activating Ser409 for nucleophilic attack. This Ser-Lys dyad mechanism differs from the typical Ser-His-Asp catalytic triad found in many serine proteases.

    The lack of effect when mutating other conserved serines, histidines, and lysines in the C-terminal domain confirms the unusual nature of E. coli SppA's catalytic mechanism. These findings support a model where the N-terminal domain, though not conserved across all SppA proteins, contributes an essential residue to the active site in E. coli SppA .

  • What are the experimental methods to clone and express recombinant E. coli SppA?

    Cloning and expressing recombinant E. coli SppA involves several key methodological steps:

    1. Gene amplification: The SppA gene can be amplified from E. coli chromosomal DNA using PCR with appropriate primers containing restriction sites (such as NdeI and HindIII) for subsequent cloning.

    2. Expression vector selection: The pET-28(a) expression vector has been successfully used for SppA expression, providing a T7 promoter system and the option to add affinity tags.

    3. PCR conditions optimization: Effective amplification has been achieved with multiple cycles of denaturation (95°C for 1 min), annealing (46°C for 1 min), and extension (72°C for 1 min and 30 s).

    4. Primer design considerations: Primers should include appropriate restriction sites for directional cloning, ensuring the correct reading frame is maintained. For example:

      • Sense primer: 5'- AAG TTG GGA GAA CAT ATG CGA ACC CTT TGG CG -3' (NdeI site underlined)

      • Antisense primer: 5'- TCA GTA CAA AAG CTT ACG CAT GTT GGC GCA GGT C -3' (HindIII site underlined)

    5. Expression host selection: E. coli strains lacking endogenous SppA expression or with other suitable modifications can be used to ensure pure recombinant protein production.

    6. Protein purification strategy: Given SppA's membrane localization, appropriate detergent extraction procedures must be employed, followed by affinity chromatography if tags are incorporated into the recombinant construct.

    7. Activity verification: Confirming that the recombinant SppA maintains catalytic activity using appropriate protease assays with signal peptide substrates.

    These experimental approaches have been successfully employed to produce and characterize recombinant SppA, enabling detailed studies of its structure, function, and catalytic mechanism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.