Recombinant Escherichia coli Lipid A biosynthesis lauroyl acyltransferase (htrB)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Escherichia coli Lipid A biosynthesis lauroyl acyltransferase, commonly known as HtrB, is an enzyme crucial for the synthesis of lipid A in Escherichia coli . Lipid A, a глав component of the lipopolysaccharide (LPS) found in the outer membrane of most Gram-negative bacteria, plays a vital role in bacterial survival and pathogenesis . HtrB, an acyltransferase, specifically catalyzes the transfer of a lauroyl group to the lipid A precursor, Kdo2-lipid IVA, during the late stages of lipid A biosynthesis .

Functional Identification and Characterization

The htrB gene was initially identified as a high-temperature requirement gene in E. coli, essential for rapid growth at temperatures above 33°C . Further research revealed that htrB encodes a lauroyl transferase involved in lipid A biosynthesis .

Key Findings:

  • HtrB-deficient mutants exhibit no lauroyl transferase activity .

  • Cells harboring htrB plasmids overproduce the transferase activity by 100-200 fold .

  • The purified enzyme incorporates one laurate residue into (Kdo)2-lipid IVA using lauroyl acyl carrier protein as the donor .

  • HtrB demonstrates substrate specificity, with laurate being incorporated 3-8 times faster than decanoate or myristate .

Enzymatic Activity and Substrate Specificity

HtrB's primary function is to catalyze the transfer of a lauroyl group from lauroyl-acyl carrier protein (ACP) to Kdo2-lipid IVA, an intermediate in lipid A biosynthesis . This reaction is essential for the completion of the lipid A molecule.

HtrB exhibits a preference for lauroyl-ACP as a substrate, with significantly reduced activity observed with other acyl-ACPs such as decanoyl-ACP and myristoyl-ACP . The enzyme's activity is also dependent on the presence of both Kdo (3-deoxy-D-manno-octulosonic acid) residues in the acceptor molecule, (Kdo)2-lipid IVA . The absence of one or both Kdo residues drastically reduces the rate of laurate incorporation .

Role in Lipid A Biosynthesis

HtrB functions in the late stages of lipid A biosynthesis, after the addition of Kdo residues to lipid IVA . The enzyme's activity is crucial for the proper acylation of lipid A, which is essential for its structural integrity and biological activity . The complete pathway model for lipid A biosynthesis in E. coli involves multiple enzymes, including LpxA, LpxC, and WaaA, highlighting the complexity and regulation of this pathway .

Implications for Antibiotic Development

The lipid A biosynthesis pathway, including HtrB, represents a promising target for the development of new antibiotics . Inhibiting HtrB could disrupt lipid A biosynthesis, leading to bacterial cell death or increased susceptibility to other antibiotics .

Tables of Data

ParameterValueReference
EnzymeHtrB (Lipid A biosynthesis lauroyl acyltransferase)
SubstrateKdo2-lipid IVA
Acyl DonorLauroyl-ACP
Preferred Acyl ChainLaurate (C12)
Relative Activity (Laurate)100%
Relative Activity (Decanoate)12.5-33%
Relative Activity (Myristate)3-12.5%

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lpxL; htrB; waaM; b1054; JW1041; Lipid A biosynthesis lauroyltransferase; Kdo(2-lipid IV(A lauroyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
lpxL
Target Protein Sequence
MTNLPKFSTALLHPRYWLTWLGIGVLWLVVQLPYPVIYRLGCGLGKLALRFMKRRAKIVH RNLELCFPEMSEQERRKMVVKNFESVGMGLMETGMAWFWPDRRIARWTEVIGMEHIRDVQ AQKRGILLVGIHFLTLELGARQFGMQEPGIGVYRPNDNPLIDWLQTWGRLRSNKSMLDRK DLKGMIKALKKGEVVWYAPDHDYGPRSSVFVPLFAVEQAATTTGTWMLARMSGACLVPFV PRRKPDGKGYQLIMLPPECSPPLDDAETTAAWMNKVVEKCIMMAPEQYMWLHRRFKTRPE GVPSRY
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of laurate from lauroyl-acyl carrier protein (ACP) to Kdo(2)-lipid IV(A), yielding Kdo(2)-(lauroyl)-lipid IV(A). It exhibits a 10-fold preference for lauroyl-ACP over myristoyl-ACP. In vitro studies indicate a slower secondary acylation reaction resulting in Kdo(2)-(dilauroyl)-lipid IV(A) formation.

Database Links
Protein Families
LpxL/LpxM/LpxP family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is HtrB in Escherichia coli and what is its primary function?

HtrB (also known as LpxL) in E. coli is an acyltransferase that catalyzes the incorporation of laurate (C12:0 fatty acid) into lipopolysaccharide (LPS) as a lipid A substituent. As part of the nine-enzyme Raetz pathway for lipid A biosynthesis, HtrB performs one of the late or secondary acyl-oxo-acyl additions to lipid A, specifically at the 2′ position of the glucosamine backbone . This enzyme is identified as a membrane-associated protein with a molecular weight of approximately 35,000 Da and is encoded by a gene located at 23.4 min on the E. coli genetic map .

How does HtrB differ from other acyltransferases in the lipid A pathway?

HtrB is distinguished from other acyltransferases like MsbB (LpxM) by its substrate specificity and the position at which it adds fatty acids. While HtrB adds laurate (C12:0) at the 2′ position of lipid A, MsbB adds myristate (C14:0) at the 3′ position . This positional specificity is critical for the final structure of lipid A and its biological activities. In the complete lipid A biosynthesis pathway, HtrB functions after the core tetraacylated lipid A structure is formed on the inner leaflet of the inner membrane but before the LPS is transported to the outer membrane .

What phenotypes are associated with htrB gene mutations in E. coli?

Insertional inactivation of the htrB gene in E. coli leads to temperature-sensitive growth with bacterial death occurring at temperatures above 33°C. At non-permissive temperatures, the mutant bacteria exhibit an arrest of cell division followed by the formation of bulges or filaments . Additionally, htrB mutants demonstrate altered membrane permeability, which can decrease cellular fitness and change resistance profiles to various antimicrobial compounds . Interestingly, the HtrB function becomes dispensable at low growth rates, suggesting conditional essentiality dependent on bacterial metabolism .

What are the most effective methods for expressing recombinant HtrB in heterologous systems?

For recombinant expression of HtrB, cloning the gene with its native regulatory elements is crucial to ensure proper expression and localization. Based on experimental approaches in the literature, effective expression can be achieved by:

  • Complementation approaches: Cloning the htrB+ gene into appropriate expression vectors (like pWSK29) with efficient ribosome binding sites .

  • Membrane targeting: Including sequences that ensure proper membrane association of the expressed protein, as HtrB is naturally membrane-associated .

  • Temperature control: Maintaining expression cultures at lower temperatures (below 33°C) when working with htrB mutant strains to ensure viability .

  • Co-expression strategies: When studying functional interactions, co-expressing HtrB with other lipid A modification enzymes on a single plasmid with individual ribosome binding sites for each gene .

A typical experimental workflow involves PCR amplification of the target gene, restriction digestion, ligation into an appropriate vector, transformation into E. coli hosts (often XL1-Blue for initial cloning and then into the strain of interest), and selection on appropriate antibiotic plates .

How can researchers accurately assess structural changes in lipid A resulting from HtrB activity or mutation?

Structural analysis of lipid A modifications requires a combination of extraction techniques and analytical methods:

Extraction Protocol:

  • Grow bacterial cultures under appropriate conditions

  • Harvest cells and extract LPS using the Bligh-Dyer method or hot phenol-water extraction

  • Perform mild acid hydrolysis to release lipid A from LPS

  • Purify lipid A using thin-layer chromatography or HPLC

Analytical Methods:

  • Mass Spectrometry: Electrospray ionization mass spectrometry (ESI-MS) is the gold standard for confirming lipid A structures and acylation patterns

  • NMR Spectroscopy: For detailed structural characterization of purified lipid A species

  • TLC/HPLC: For initial separation and identification of lipid A variants

  • Bioactivity Assays: Using HEK293 cells transfected with TLR4/MD2 to measure immunostimulatory potential of different lipid A structures

For example, when analyzing chimeric LPS with altered lipid A structure, researchers can detect the replacement of laurate (C12) with palmitate (C16) through mass spectrometry fragmentation patterns that reveal the specific positions and identities of acyl chains .

What cell-based assays can evaluate the functional consequences of HtrB-modified lipid A?

Several cell-based assays are employed to evaluate how HtrB-modified lipid A affects biological responses:

Immunological Response Assays:

  • TLR4 Activation Assay: Using HEK293 cells transfected with TLR4/MD2 and a reporter gene to measure activation levels by different lipid A variants

  • Cytokine Production: Measuring IL-8 secretion from endothelial cells and monocytes exposed to purified LPS samples

  • Inflammatory Response Assessment: Quantifying NF-κB activation and downstream inflammatory mediators

Bacterial Fitness and Resistance Assays:

  • Antimicrobial Peptide Resistance: Determining minimum inhibitory concentrations (MICs) of polymyxin and other cationic antimicrobial peptides

  • Membrane Permeability Tests: Using fluorescent dyes like propidium iodide or SYTOX Green to assess membrane integrity

  • Growth Curve Analysis: Comparing growth rates of wild-type and htrB mutant strains under various temperatures and stress conditions

Data from these assays should be presented in comparative tables showing wild-type E. coli, htrB mutants, and complemented strains to clearly demonstrate the functional impact of HtrB modification.

How do homologs of HtrB across different bacterial species exhibit functional diversity?

HtrB homologs across bacterial species show remarkable functional diversity despite sequence similarities:

Bacterial SpeciesHtrB HomologPreferred SubstrateSubstrate PositionUnique Features
E. coliHtrB (LpxL)Laurate (C12:0)2′ positionTemperature-sensitive phenotype when deleted
P. aeruginosaHtrB1Site-specific fatty acid2′ positionContributes to antimicrobial resistance
P. aeruginosaHtrB2Site-specific fatty acidDifferent positionAffects membrane integrity differently than HtrB1
P. gingivalisHtrB homologPalmitate (C16:0)2′ positionPreferentially transfers longer-chain fatty acids

Research on these differences includes:

  • Complementation Studies: Expressing HtrB homologs from different species in E. coli htrB mutants to assess functional conservation and specificity

  • Chimeric Enzyme Analysis: Creating fusion proteins to identify domains responsible for substrate specificity

  • Structural Biology Approaches: Comparing crystal structures of different HtrB homologs to understand mechanism of action

The P. gingivalis HtrB homolog, when expressed in E. coli, produces a chimeric LPS with palmitate (C16) in the position normally occupied by laurate (C12), demonstrating the enzyme's preference for longer-chain fatty acids while maintaining positional specificity .

What mechanisms regulate HtrB expression and activity in response to environmental conditions?

HtrB regulation occurs through multiple mechanisms:

Transcriptional Regulation:

  • Temperature-responsive elements in promoter regions that alter expression at different growth temperatures

  • Potential response to envelope stress through two-component regulatory systems

Post-translational Regulation:

  • Membrane microenvironment effects on enzyme activity and substrate accessibility

  • Potential interaction with other membrane proteins or lipids that modulate activity

Environmental Factors Affecting HtrB:

  • Temperature: HtrB function becomes more critical at higher temperatures (>33°C)

  • Growth Rate: HtrB is dispensable at slow growth rates but essential during rapid growth

  • Nutrient Availability: Changes in available fatty acid pools may affect substrate utilization by HtrB

To study these regulatory mechanisms, researchers can utilize:

  • Reporter gene fusions to monitor transcriptional responses

  • Mass spectrometry-based proteomics to track protein abundance changes

  • Site-directed mutagenesis to identify regulatory domains

  • Comparative growth studies under varying environmental conditions

How do HtrB-mediated lipid A modifications influence bacterial resistance to host immune defenses?

HtrB-mediated lipid A acylation patterns significantly impact bacterial interactions with host immunity:

  • Antimicrobial Peptide Resistance:

    • Altered acylation affects membrane charge and hydrophobicity, modifying interactions with cationic antimicrobial peptides

    • Strains with modified lipid A (particularly 4′-dephosphorylated species) display increased resistance to polymyxin

  • TLR4-Mediated Recognition:

    • Lipid A from htrB mutants exhibits reduced ability to activate human embryonic kidney 293 (HEK293) cells transfected with TLR4/MD2

    • LPS from htrB mutants shows decreased ability to stimulate IL-8 secretion in both endothelial cells and monocytes

  • Cell-Type Specific Responses:

    • Chimeric LPS containing palmitate instead of laurate (as with the P. gingivalis HtrB homolog) displays differential activity in different cell types:

      • Wild-type activity in endothelial cells

      • Reduced activity in monocytes

  • Membrane Integrity and Stress Resistance:

    • HtrB mutations alter membrane permeability, potentially affecting survival in host environments

    • The resulting membrane changes may influence resistance to oxidative stress, pH fluctuations, and other host defense mechanisms

These alterations in host-pathogen interactions make HtrB an attractive target for potential antimicrobial development and vaccine design strategies.

What strategies can overcome difficulties in purifying active recombinant HtrB enzyme?

Purifying active membrane-associated acyltransferases like HtrB presents several challenges:

Common Challenges and Solutions:

ChallengeSolution StrategyMethodological Approach
Membrane associationDetergent solubilizationUse mild detergents like n-dodecyl-β-D-maltoside (DDM) or CHAPS at optimized concentrations
Protein instabilityTemperature controlMaintain purification steps below 30°C to preserve HtrB activity
Low expression yieldsExpression system optimizationUse C41/C43(DE3) E. coli strains specialized for membrane protein expression
Loss of activity during purificationAddition of lipid/substrate stabilizersInclude phospholipids or substrate analogs in purification buffers
Proper foldingChaperone co-expressionCo-express with molecular chaperones like GroEL/GroES

For functional studies, an alternative approach is using membrane preparations rather than purified enzyme. This maintains the natural lipid environment and often preserves enzymatic activity better than purified preparations.

During protein purification, it's advisable to track activity with specific acyltransferase assays throughout the process to ensure the final preparation retains catalytic function.

How can researchers differentiate between the direct effects of HtrB mutation and secondary consequences on bacterial physiology?

Distinguishing primary from secondary effects requires careful experimental design:

Recommended Approaches:

  • Complementation Studies: Expressing wild-type HtrB in mutant strains should reverse direct effects but may not fully rescue secondary adaptations

  • Inducible Expression Systems: Using tightly controlled inducible promoters to express HtrB allows temporal control and observation of immediate versus delayed effects

  • Point Mutations vs. Gene Deletion:

    • Catalytically inactive point mutations that preserve protein structure can separate enzymatic activity from potential structural roles

    • Comparison with complete gene deletion phenotypes helps identify non-catalytic functions

  • Synthetic Lethal Screens: Identifying genes whose disruption is only lethal in an htrB mutant background can reveal compensatory pathways

  • Metabolic Profiling: Comprehensive lipidomics and metabolomics analysis can map broader changes in cellular physiology resulting from HtrB deficiency

  • Time-Course Experiments: Following changes immediately after HtrB inactivation versus long-term adaptation

When analyzing results, researchers should present data in tables comparing immediate versus long-term effects, and direct effects (lipid A structure changes) versus indirect consequences (membrane permeability, stress responses, etc.).

What considerations are important when designing experiments to study HtrB function across different bacterial species?

Cross-species HtrB functional studies require careful consideration of several factors:

Key Experimental Design Considerations:

  • Sequence Homology Assessment:

    • Conduct comprehensive bioinformatic analysis of potential HtrB homologs

    • Be aware that sequence similarity alone may not predict functional equivalence

  • Heterologous Expression Controls:

    • Optimize codon usage for the host organism

    • Consider differences in preferred membrane environments

    • Test expression levels and localization before functional studies

  • Lipid A Structural Diversity:

    • Account for species-specific differences in baseline lipid A structure

    • Different species may have varying numbers of acylation sites and phosphorylation patterns

  • Temperature Sensitivity:

    • Adjust experimental temperatures based on the thermal requirements of both donor and recipient species

    • Remember that E. coli htrB mutants are temperature-sensitive above 33°C

  • Complementation Analysis:

    • Design experiments with appropriate negative controls (empty vector) and positive controls (cognate HtrB from the same species)

    • Use quantitative rather than qualitative readouts when possible

  • Substrate Availability:

    • Ensure the host organism produces the preferred acyl donor for the heterologous HtrB

    • Consider supplementing growth media with specific fatty acids if necessary

For example, when expressing the P. gingivalis HtrB homolog in E. coli, researchers discovered it maintained positional specificity but incorporated a different fatty acid (palmitate instead of laurate), revealing important insights about substrate preference while maintaining enzyme function .

How might HtrB-modified lipid A be exploited for vaccine development and immunomodulation?

HtrB-modified lipid A shows promising potential for vaccine and immunomodulatory applications:

Vaccine Adjuvant Development:

  • Engineered E. coli strains expressing modified HtrB could produce lipid A variants with optimized adjuvant properties

  • Strains co-expressing HtrB with other lipid A-modifying enzymes (e.g., LpxE, LpxF, LpxQ) can generate novel phosphate-free lipid A derivatives with altered immunostimulatory profiles

  • The differential activation of cell types observed with chimeric LPS (e.g., P. gingivalis HtrB in E. coli) could be exploited to target specific immune responses

Therapeutic Applications:

  • Engineered lipid A with reduced inflammatory potential could serve as TLR4 antagonists for autoimmune diseases

  • Modified lipid A species might be developed as immunomodulators that separate beneficial immune activation from harmful inflammatory responses

Research Methodology Considerations:

  • High-throughput screening systems to assess immunological activity of various HtrB-modified lipid A structures

  • Animal models to evaluate adjuvant efficacy and safety

  • Structural studies correlating specific lipid A modifications with immunological outcomes

The ability to generate specific, controlled modifications to lipid A structure through HtrB engineering represents an important avenue for developing next-generation vaccine adjuvants and immunotherapeutics .

What is the potential for targeting HtrB-mediated lipid A biosynthesis in antimicrobial drug development?

HtrB presents several characteristics that make it an attractive antimicrobial target:

Target Validation Evidence:

  • HtrB is essential for E. coli growth at physiological temperatures (>33°C)

  • HtrB mutants show altered membrane permeability and increased sensitivity to certain antimicrobials

  • The enzyme is conserved across many Gram-negative pathogens but has limited homology to human proteins

Drug Development Approaches:

  • Structure-Based Design: Developing small molecule inhibitors based on structural insights of the enzyme's active site

  • Substrate Analogs: Creating competitive inhibitors that mimic natural substrates

  • Allosteric Inhibitors: Targeting regulatory sites that affect enzyme function

  • Combination Therapies: Pairing HtrB inhibitors with existing antimicrobials to enhance efficacy

Potential Advantages of HtrB Inhibitors:

  • Species-specific targeting based on differences between HtrB homologs

  • Possible synergy with host immune defenses by increasing bacterial susceptibility to antimicrobial peptides

  • Potential activity against antibiotic-resistant strains since lipid A biosynthesis is rarely targeted by conventional antibiotics

Development Challenges:

  • Designing inhibitors that can penetrate the Gram-negative outer membrane

  • Achieving selectivity between bacterial HtrB and mammalian acyltransferases

  • Addressing potential toxicity issues related to LPS/lipid A release during bacterial lysis

Research methods should include high-throughput screening approaches, medicinal chemistry optimization, and appropriate in vitro and in vivo models to evaluate efficacy and safety.

How do compensatory mechanisms respond to HtrB deficiency in different bacterial species?

Bacteria employ diverse compensatory mechanisms when HtrB function is compromised:

Observed Compensatory Responses:

Compensatory MechanismBacterial SpeciesDetection MethodFunctional Consequence
Altered fatty acid incorporationE. coliMass spectrometry analysis of lipid AModified immune recognition
Changes in membrane phospholipid compositionMultiple speciesLipidomic analysisMaintenance of membrane integrity
Upregulation of other acyltransferasesP. aeruginosaTranscriptomics/proteomicsPartial restoration of acylation patterns
Activation of envelope stress responseE. coli, othersReporter gene assaysEnhanced survival under stress conditions
Modification of growth rateE. coliGrowth curve analysisAdaptation to temperature sensitivity

Research Approaches to Study Compensation:

  • Comparative Genomics: Identifying potential redundant enzymes across species

  • Transcriptomics/Proteomics: Measuring global expression changes in response to HtrB deficiency

  • Synthetic Lethal Screening: Finding genes that become essential in htrB mutant backgrounds

  • Suppressor Mutation Analysis: Isolating strains that overcome htrB deficiency and characterizing the compensatory mutations

  • Metabolic Flux Analysis: Examining redirected lipid biosynthetic pathways

The study of these compensatory mechanisms not only provides insights into bacterial adaptation but may also reveal additional targets for antimicrobial development and help predict potential resistance mechanisms to HtrB inhibitors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.