Recombinant Escherichia coli Lipid A biosynthesis myristoyltransferase (lpxM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
lpxM; msbB; b1855; JW1844; Lipid A biosynthesis myristoyltransferase; Kdo(2-lauroyl-lipid IV(A myristoyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-323
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
lpxM
Target Protein Sequence
METKKNNSEYIPEFDKSFRHPRYWGAWLGVAAMAGIALTPPKFRDPILARLGRFAGRLGK SSRRRALINLSLCFPERSEAEREAIVDEMFATAPQAMAMMAELAIRGPEKIQPRVDWQGL EIIEEMRRNNEKVIFLVPHGWAVDIPAMLMASQGQKMAAMFHNQGNPVFDYVWNTVRRRF GGRLHARNDGIKPFIQSVRQGYWGYYLPDQDHGPEHSEFVDFFATYKATLPAIGRLMKVC RARVVPLFPIYDGKTHRLTIQVRPPMDDLLEADDHTIARRMNEEVEIFVGPRPEQYTWIL KLLKTRKPGEIQPYKRKDLYPIK
Uniprot No.

Target Background

Function
This recombinant *Escherichia coli* Lipid A biosynthesis myristoyltransferase (LpxM) catalyzes the transfer of myristate from myristoyl-acyl carrier protein (ACP) to Kdo2-(lauroyl)-lipid IVA, forming Kdo2-lipid A. It likely also catalyzes myristate transfer to Kdo2-(palmitoleoyl)-lipid IVA to produce the cold-adapted Kdo2-lipid A. In vitro studies show acylation of Kdo2-lipid IVA, with approximately 100-fold faster acylation of Kdo2-(lauroyl)-lipid IVA compared to other substrates. While capable of utilizing lauroyl-ACP, it exhibits a slight kinetic preference for myristoyl-ACP.
Gene References Into Functions
  1. The lpxM gene plays a crucial role in pathogenicity and biological activity. PMID: 23856328
Database Links
Protein Families
LpxL/LpxM/LpxP family, LpxM subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the basic function of LpxM in lipid A biosynthesis?

LpxM (lipid A biosynthesis myristoyltransferase) functions as a lysophospholipid acyltransferase that catalyzes the final secondary acylation step in the biosynthesis of lipid A. It transfers acyl chains from acyl-ACP (acyl carrier protein) to lipid A precursors, specifically to the R-3-hydroxyacyl chains. This process is critical for the maturation of lipid A, which constitutes the outer leaflet of the outer membrane in Gram-negative bacteria. The fully acylated lipid A is essential for maintaining the integrity of the bacterial outer membrane, which acts as a permeability barrier to prevent uptake of bactericidal compounds .

What phenotypic effects result from LpxM deletion in different bacterial species?

While LpxM is not essential for bacterial growth under standard laboratory conditions, its deletion results in diverse phenotypes across bacterial species:

  • In Klebsiella pneumoniae: Deletion of lpxM increases outer membrane permeability, leading to heightened sensitivity to cationic antimicrobial peptides (CAMPs).

  • In Acinetobacter baumannii, Escherichia coli, and Salmonella typhimurium: Functional LpxM is required for CAMP resistance, likely due to its role in maintaining proper outer membrane integrity.

  • In Vibrio cholerae: The LpxM ortholog LpxN transfers 3-hydroxylaurate to the 3′-linked acyl chain on lipid A precursors, which is subsequently modified with glycine to confer CAMP resistance.

These observations demonstrate that LpxM contributes both directly and indirectly to antimicrobial resistance mechanisms in Gram-negative bacteria through its role in lipid A maturation and outer membrane stability .

What high-throughput assays can be used to measure LpxM activity, and how do they compare to traditional methods?

A significant advancement in studying LpxM activity is the development of a high-throughput solid-phase-extraction triple quadrupole mass spectrometry (SPE-MS) assay using an Agilent RapidFire 300 and AB SCIEX 5500 mass spectrometer. This method offers several advantages over traditional approaches:

Traditional methods:

  • Rely on production of radiolabeled lipids

  • Require thin-layer chromatography (TLC) for analysis

  • Low-throughput, time-consuming process

  • Limited quantitative capabilities

SPE-MS method:

  • Measures formation of holo-ACP through phosphopantetheine ejection ions

  • Processes one sample every 7 seconds

  • Provides good signal-to-noise separation (>3 dB)

  • Linear detection down to ~100 nM of holo-ACP product

  • No additional sample preparation required

  • Can detect previously unreported activities (such as thioesterase activity)

This high-throughput assay enables rapid characterization of LpxM enzymatic activity and facilitates screening for potential inhibitors. The method detects the preferential gas-phase cleavage of the prosthetic group and any attached thioester for quantitation from intact ACP, providing a sensitive and efficient approach to measure both acyltransferase and thioesterase activities of LpxM .

How can recombinant LpxM be effectively expressed and purified for structural and biochemical studies?

Effective expression and purification of recombinant LpxM requires specialized approaches due to its membrane-associated nature:

  • Expression system:

    • Heterologous overexpression in E. coli membranes

    • Use of N-terminally polyhistidine-tagged constructs

    • Expression of both native and selenomethionine (SeMet)-derivatized proteins for structural studies

  • Purification protocol:

    • Detergent solubilization of membrane fractions containing LpxM

    • Initial purification using immobilized metal affinity chromatography (IMAC)

    • Further purification by ion exchange chromatography

    • Concentration to approximately 21 mg/mL for crystallization studies

  • Crystallization conditions:

    • Sitting-drop vapor diffusion method at room temperature

    • Optimal conditions: 200 mM NaBr, 2.2 M (NH₄)₂SO₄

    • Protein:mother liquor ratio of 70:30

    • Cryoprotection with 20% glycerol addition to mother liquor solution

  • Data collection:

    • X-ray diffraction at synchrotron sources (e.g., Advanced Light Source beamline 5.0.2)

    • Collection at specific wavelengths (1.000 Å for native and 0.9797 Å for Se-Met crystals)

    • Structure determination using single anomalous dispersion methods

This comprehensive approach enables the production of high-quality recombinant LpxM suitable for detailed structural and biochemical characterization .

What strategies can be employed to identify and characterize LpxM inhibitors for antimicrobial development?

Several strategic approaches can be implemented for the identification and characterization of LpxM inhibitors:

  • Target-based approach using the high-throughput SPE-MS assay:

    • Screen for compounds that inhibit acyltransferase activity

    • Also screen for molecules that affect the thioesterase activity

    • Prioritize inhibitors that stabilize the LpxM-acyl-ACP complex rather than those competing with lipid IVA

  • Structure-aided inhibitor discovery:

    • Utilize the solved crystal structure of LpxM to perform in silico screening

    • Focus on the active site and substrate binding regions

    • Design molecules that interfere with the catalytic dyad or substrate positioning

  • Novel targeting strategies:

    • Develop inhibitors that stabilize the LpxM-acyl-ACP complex (corresponding to step 5 in the proposed mechanism)

    • This approach could both prevent lipid A maturation and sequester acyl-ACP

    • The resulting depletion of ACP pools could cause broad metabolic disruption in bacteria

  • Evaluation criteria:

    • Measure effects on both acyltransferase and thioesterase activities

    • Assess impact on bacterial outer membrane integrity

    • Determine synergistic effects with existing antibiotics

    • Evaluate ability to overcome existing resistance mechanisms

This multi-faceted approach may lead to novel inhibitors that prevent lipid A maturation in Gram-negative pathogens, potentially enhancing the uptake of existing antibiotics whose efficacy is currently limited by poor permeability .

What is the proposed mechanism for LpxM enzymatic activity, and what evidence supports this model?

The proposed mechanism for LpxM is an ordered-binding and "reset" mechanism, supported by several experimental observations:

  • Proposed mechanism steps:
    a. LpxM binds to a lipid acceptor substrate (lipid IVA, Kdo₂-lipid IVA, or Kdo₂-(lauryl)-lipid IVA)
    b. Lauryl-ACP then binds to the enzyme-lipid complex
    c. The acceptor lipid is positioned with the hydroxyl of the R-3-hydroxyacyl chain near the catalytic dyad
    d. Acyl chain transfer is catalyzed, generating holo-ACP and acylated lipid A products
    e. Products are released, resetting the enzyme for another catalytic cycle

  • Supporting evidence:

    • Kinetic analysis showing an apparent KM of 1.7 ± 0.6 μM for lipid IVA

    • Demonstration that LpxM can produce both penta- and hexa-acylated lipid A species

    • Discovery of thioesterase activity in the absence of lipid acceptor

    • Detection of free lauric acid production when LpxM is incubated with lauryl-ACP

    • Observation that enzyme-dependent hydrolysis is ~60-fold greater than the spontaneous rate

  • Reset mechanism hypothesis:
    If lauryl-ACP binds first, the lipid acceptor is sterically hindered from binding, creating a non-productive state. The thioesterase activity then hydrolyzes lauryl-ACP to holo-ACP and laurate, regenerating active enzyme at the cost of one ATP (needed to regenerate lauryl-ACP). This provides an energetically favorable way to reset the enzyme compared to synthesizing new LpxM molecules .

How does the substrate specificity of LpxM vary across different bacterial species?

LpxM orthologs across bacterial species exhibit substantial variation in substrate specificity:

SpeciesSubstrate Specificity CharacteristicsNotable Features
E. coliTypically uses Kdo₂-lauryl-lipid IVATerminal enzyme in the Raetz pathway
Neisseria meningitidisCan use lipid IVA even when kdtA is knocked outProduces fully acylated lipid A without Kdo transferase
Pseudomonas aeruginosaCan act on purified lipid IVAFunctions even when CMP-Kdo synthase is inhibited
Acinetobacter baumanniiAdds lauryl groups to R-3-hydroxyacyl chains at both 3'- and 2-positionsProduces hepta-acylated lipid A; requires flexibility in active site

Sequence alignment analysis reveals that LpxM orthologs with predicted substrate promiscuity (Neisseria, Pseudomonas, and Acinetobacter) align more closely together compared to orthologs with more specific acyl transfer activities. This suggests the existence of common mutations that relax ligand specificity. The A. baumannii LABLAT proteins (including LpxM) likely lack a defined order of operations, as both AbLpxL and AbLpxM can produce lipid products in the absence of the other .

What dual enzymatic activities does LpxM possess, and what is their biological significance?

LpxM possesses two distinct enzymatic activities, each with important biological implications:

  • Acyltransferase activity:

    • Transfers acyl chains from acyl-ACP donors to lipid A precursor acceptors

    • Catalyzes the final step in lipid A biosynthesis

    • Essential for producing fully acylated lipid A that maintains outer membrane integrity

    • Contributes to resistance against cationic antimicrobial peptides (CAMPs)

  • Acylprotein thioesterase activity:

    • Hydrolyzes acyl-ACP to produce holo-ACP and free fatty acid in the absence of a lipid acceptor

    • Enzyme-dependent hydrolysis occurs at a rate ~60-fold greater than spontaneous hydrolysis

    • Previously unreported activity discovered through direct measurement of holo-ACP production

Biological significance of dual activities:

  • The thioesterase activity likely serves as a "reset" mechanism when the enzyme binds substrates in an unproductive order

  • Prevents sequestration of acyl-ACP when lipid acceptor substrates are scarce

  • Allows bacteria to efficiently conserve resources as the supply of lipid A precursors fluctuates

  • Reflects an adaptation to the cells' changing energy status

  • May have regulatory functions in controlling lipid A biosynthesis rates

These dual activities suggest that LpxM and possibly other LPLAT proteins may have multiple functions that contribute to metabolic regulation in addition to their primary catalytic roles .

How do the structural features of bacterial LABLATs compare to other members of the LPLAT superfamily?

Structural comparison between bacterial LABLATs (Lipid A Biosynthesis Late AcylTransferases) and other LPLAT superfamily members reveals both conserved elements and significant differences:

This comparative analysis suggests that while the catalytic core may be conserved across LPLAT proteins, bacterial LABLATs like LpxM have evolved distinct structural features that likely reflect their specialized functions in lipid A biosynthesis .

What are the key functional differences between LpxM and other acyltransferases in the lipid A biosynthetic pathway?

LpxM exhibits several distinctive functional characteristics when compared to other acyltransferases in the lipid A biosynthetic pathway:

  • Position in the biosynthetic pathway:

    • LpxM typically functions as the terminal enzyme in the Raetz pathway

    • Catalyzes the final acylation step in lipid A maturation

    • Acts on lipid A precursors that have already undergone initial acylation steps

  • Substrate specificity differences:

    • LpxM generally transfers secondary acyl chains to specific positions

    • In E. coli, LpxM transfers a myristoyl group to the R-3-hydroxyacyl chain at the 3'-position

    • In A. baumannii, LpxM adds lauryl groups to both the 3'- and 2-positions

    • Shows variable substrate promiscuity compared to other acyltransferases

  • Unique enzymatic properties:

    • Possesses both acyltransferase and acylprotein thioesterase activities

    • The thioesterase activity appears to be a distinguishing feature not previously reported in other lipid A acyltransferases

    • May have a unique "reset" mechanism not characterized in other enzymes in the pathway

  • Species-specific variations:

    • Different bacterial species show variations in LpxM function and substrate specificity

    • In some species (like A. baumannii), LpxM exhibits more promiscuous activity compared to orthologs in other species

    • The order of operations between LpxM and other acyltransferases (like LpxL) may vary between species

These functional differences highlight the specialized and adaptive role of LpxM in the lipid A biosynthetic pathway, which may reflect evolutionary adaptations to specific bacterial environments and requirements for outer membrane composition .

How can insights from LpxM structure and function be applied to understand other LPLAT family enzymes?

The structural and functional characterization of LpxM provides valuable insights that can be applied to understand other LPLAT family enzymes:

  • Methodological applications:

    • The high-throughput SPE-MS assay developed for LpxM can be adapted to study other LPLAT enzymes

    • This platform enables rapid characterization of enzyme kinetics and substrate specificity

    • Could reveal previously undetected secondary activities in other LPLAT proteins

    • May facilitate comprehensive structure-function relationship studies across the superfamily

  • Mechanistic implications:

    • The ordered-binding and "reset" mechanism proposed for LpxM may apply to other LPLAT enzymes

    • The discovery of thioesterase activity suggests that other LPLATs might possess secondary activities not yet identified

    • Regulatory roles of these secondary activities could be a common feature across the LPLAT superfamily

  • Structural insights:

    • Comparison between bacterial LpxM and the squash GPAT identifies which structural elements are conserved

    • These conserved elements may be present in mammalian LPLAT homologs

    • Unique structural features may help classify subfamilies within the larger LPLAT superfamily

  • Evolutionary considerations:

    • Analysis of sequence divergence among LpxM orthologs with different substrate specificities could inform understanding of how substrate recognition evolves in other LPLAT families

    • May provide insights into how new enzymatic functions emerge within conserved structural frameworks

These translatable insights establish a foundation for broad characterization of LPLAT structure-function relationships, potentially enabling targeted studies of clinically relevant LPLAT proteins in various biological systems .

How might inhibition of LpxM contribute to novel antimicrobial strategies?

Inhibition of LpxM presents several promising avenues for novel antimicrobial strategies:

  • Membrane permeabilization approach:

    • LpxM inhibition prevents complete acylation of lipid A

    • Underacylated lipid A alters outer membrane integrity

    • Increased membrane permeability can potentiate the uptake of existing antibiotics

    • This could revitalize the efficacy of antibiotics currently limited by poor penetration

  • Immune modulation strategy:

    • Modified lipid A structure changes its interaction with the innate immune system

    • LpxM inhibition could result in lipid A variants that elicit altered immune responses

    • May reduce excessive inflammatory responses in severe infections

    • Could affect bacterial evasion of host immune defenses

  • Resistance reversal applications:

    • LpxM is required for resistance to cationic antimicrobial peptides (CAMPs) in multiple species

    • Inhibition could restore susceptibility to host defense peptides and polymyxin antibiotics

    • May be especially effective against highly resistant Gram-negative pathogens

    • Potential for combination therapy with CAMPs or polymyxins

  • Novel targeting strategies:

    • Inhibitors that stabilize the LpxM-acyl-ACP complex could provide dual benefits

    • Prevention of lipid A maturation directly affects membrane integrity

    • Sequestration of acyl-ACP depletes ACP pools, potentially causing broad metabolic disruption

    • This approach targets a non-essential but functionally critical pathway, potentially reducing selection pressure for resistance

These strategies highlight the potential of LpxM inhibition to address the growing challenge of antimicrobial resistance, particularly in Gram-negative pathogens where new therapeutic approaches are urgently needed .

What methods can be used to evaluate the effects of LpxM inhibition on bacterial membrane integrity and antibiotic susceptibility?

Comprehensive evaluation of LpxM inhibition effects requires multiple complementary approaches:

  • Membrane integrity assessment:

    • Fluorescent dye uptake assays (e.g., propidium iodide, SYTOX Green)

    • Measurement of leakage of periplasmic enzymes (e.g., β-lactamase)

    • Atomic force microscopy to visualize changes in membrane structure

    • Freeze-fracture electron microscopy to examine membrane organization

    • Laurdan generalized polarization to assess membrane fluidity changes

  • Lipid A structural analysis:

    • Mass spectrometry (MALDI-TOF, LC-MS/MS) to characterize lipid A modifications

    • Thin-layer chromatography to separate and identify lipid A species

    • NMR spectroscopy for detailed structural characterization

    • Comparison of lipid profiles between treated bacteria and genetic knockouts of lpxM

  • Antibiotic susceptibility testing:

    • Minimum inhibitory concentration (MIC) determination for various antibiotics

    • Fractional inhibitory concentration index (FICI) to assess synergistic effects

    • Time-kill assays to evaluate bactericidal activity kinetics

    • In vitro hollow-fiber infection models to simulate pharmacokinetics/pharmacodynamics

  • Resistance to host defense mechanisms:

    • Susceptibility testing to various cationic antimicrobial peptides

    • Serum resistance assays

    • Phagocytosis efficiency by macrophages and neutrophils

    • Complement-mediated killing assays

  • In vivo efficacy evaluation:

    • Animal infection models to assess pathogen clearance

    • Combination therapy studies with existing antibiotics

    • Measurement of inflammatory markers to evaluate immune modulation

    • Assessment of bacterial burden in various tissues

These methodologies provide a comprehensive framework for evaluating LpxM inhibitors, from their direct effects on bacterial physiology to their potential therapeutic applications in infection models .

What are the potential challenges and considerations in developing LpxM inhibitors as antimicrobial agents?

Development of LpxM inhibitors as antimicrobial agents presents several challenges and considerations:

  • Selectivity and specificity issues:

    • LPLAT proteins exist across all domains of life, including humans

    • Need to ensure selective inhibition of bacterial LpxM without affecting mammalian LPLAT functions

    • Structural differences between bacterial LABLATs and mammalian LPLATs must be exploited

    • Potential off-target effects on human metabolism require careful assessment

  • Physicochemical and pharmacokinetic challenges:

    • Inhibitors targeting the lipid IVA binding site might have unfavorable properties (high molecular mass, high lipophilicity)

    • Need to design molecules that can penetrate the bacterial outer membrane

    • Required balance between lipophilicity for membrane penetration and hydrophilicity for solubility

    • Potential for limited systemic distribution due to physicochemical properties

  • Efficacy considerations:

    • LpxM is not essential for bacterial growth under laboratory conditions

    • Inhibition may not directly kill bacteria but rather sensitize them to other antibiotics

    • Effectiveness may vary across bacterial species due to differences in LpxM orthologs

    • Need for combination therapy approaches requires complex clinical development

  • Resistance development potential:

    • Bacteria might evolve compensatory mechanisms to maintain outer membrane integrity

    • Alternative acyltransferases might be upregulated or mutated to accommodate LpxM functions

    • Selection pressure in vivo may differ from laboratory conditions

    • Need for resistance evolution studies in clinically relevant models

  • Regulatory and development considerations:

    • Novel mechanism of action requires extensive safety and efficacy validation

    • Combination approaches complicate clinical trial design and regulatory approval

    • Biomarkers to confirm target engagement in vivo need development

    • Appropriate patient populations for clinical trials must be carefully defined

Addressing these challenges requires interdisciplinary approaches combining structural biology, medicinal chemistry, microbiology, and clinical pharmacology to develop effective LpxM inhibitors while mitigating potential limitations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.