Recombinant Escherichia coli Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms and Substrate Specificity

MsbA exhibits polyspecific transport activity, mediating ATP-dependent lipid A translocation and ATP/proton gradient-dependent phospholipid flipping .

Lipid A Transport

  • Substrate: Lipid A (hexa-acylated LPS anchor) and LPS precursors (e.g., RaLPS, ReLPS).

  • Energetics: Requires ATP hydrolysis alone .

  • Binding Affinity: Low micromolar range (Kd ~1–10 µM) .

Phospholipid Transport

  • Substrates: PE, PS, PG, PC, SM (headgroup- or acyl chain-labeled).

  • Energetics: Requires both ATP hydrolysis and proton gradient .

  • Activity: Maximal in E. coli lipid proteoliposomes (7.7 nmol lipid/mg protein/20 min for NBD-PE) .

Inhibition Studies:
Lipid A competitively inhibits phospholipid transport, while quinoline derivatives (e.g., G332) block MsbA function, causing membrane defects and bacterial cell death .

Functional Studies

Study FocusMethodKey FindingsSource
Lipid Flippase ActivityProteoliposomes + NBD-lipidsATP-dependent PE, PS, PG, PC, SM translocation; lipid A inhibition observed
Energetic RequirementsATPase assays + proton gradientLipid A: ATP-dependent; PE: ATP + proton gradient-dependent
Drug InteractionsHigh-throughput screeningQuinoline inhibitors (e.g., G332) disrupt MsbA function, causing membrane stress

Role in Bacterial Pathogenesis and Drug Development

MsbA is essential for bacterial viability, as its depletion leads to lipid A accumulation, membrane instability, and cell death . It has emerged as a target for antibacterial therapies, with small-molecule inhibitors showing potential against E. coli, Klebsiella pneumoniae, and Enterobacter cloacae .

Recombinant Protein Applications

The recombinant His-tagged MsbA is widely used in:

  • Biochemical Assays: ATPase activity measurements, lipid-binding studies .

  • Structural Biology: X-ray crystallography and cryo-EM .

  • Drug Screening: High-throughput inhibitor discovery .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: Our standard shipping includes normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development with the specified tag.
Synonyms
msbA; b0914; JW0897; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA; Lipid flippase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
msbA
Target Protein Sequence
MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ
Uniprot No.

Target Background

Function
MsbA is involved in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) generates energy. MsbA exhibits ATPase activity and may transport glycerophospholipids. In proteoliposomes, it mediates the ATP-dependent flipping of various phospholipid and glycolipid derivatives. MsbA may also function as a multidrug transporter.
Gene References Into Functions
  1. The ABC exporter MsbA can couple ATP hydrolysis to an adenylate kinase activity, where ADP is converted into AMP and ATP. Single-point mutations reveal that both ATPase and adenylate kinase mechanisms are associated with the same conserved motifs of the nucleotide-binding domain. PMID: 28004795
  2. Data demonstrate that the conformational space of lipid ABC transporter MsbA changes upon vanadate trapping. PMID: 29069570
  3. Research indicates that the twisting motion of ATP-binding cassette transporter MsbA plays a significant role in the rearrangement of transmembrane helices and the opening of transmembrane domains on the periplasmic side. PMID: 26148303
  4. Data suggest that the E208A mutation disrupts the inward- to outward-facing conformational switch in ATP-binding cassette transport protein MsbA. PMID: 23306205
  5. Findings show that the isolated MsbA nucleotide-binding domain hydrolyzed ATP with V(max) = 45 nmol mg(-1) min(-1), comparable to the full-length transporter. PMID: 22593573
  6. Catalytic activity of MsbA reconstituted in nanodisc particles is modulated by remote interactions with the bilayer. PMID: 22020218
  7. Analysis of the E506Q and H537A dysfunctional mutants in the E. coli ABC transporter MsbA. PMID: 21462989
  8. Investigation of the catalytic mechanism using mutants: L511P prevents effective ATP hydrolysis; D512G hydrolyzes ATP at a rate 3-fold faster than wild type; both mutants bind ATP at near-wild-type levels but are unable to maintain cell viability. PMID: 21344946
  9. This is the first report of a direct measurement of lipid flippase activity of purified MsbA in a reconstituted system. PMID: 20412049
  10. Results suggest that deletion of the C-terminal alpha-helices may play a role in facilitating the outward-facing nucleotide-bound crystal structure of EcMsbA. PMID: 20179345
  11. MsbA facilitates the rapid translocation of some lipids from the cytoplasmic to the periplasmic side of the inner membrane in living cells. PMID: 15304478
  12. Spin-labeling & electron paramagnetic resonance spectroscopy was used to characterize the conformational motion coupling energy expenditure to substrate translocation. Results establish the structural dynamic basis of the power stroke in MDR ABC transporters. PMID: 15890883
  13. Lipopolysaccharide stabilizes the crystal packing of the ABC transporter MsbA. PMID: 16511120
  14. The LSGGQ NBD consensus sequence is consistent with an alpha-helical conformation, and these residues maintain extensive tertiary contacts throughout hydrolysis. PMID: 17029409
  15. Comparison among 4 x-ray structures of MsbA, trapped in different conformations (2 nucleotide-bound structures & 2 without nucleotide) reveals a flexible hinge formed by extracellular loops 2 & 3, allowing large ranges of motion. PMID: 18024585
  16. Proline to serine substitutions at either residue 18 or 50 of MsbA relieved the Kdo growth dependence observed in the isogenic wild-type strain. PMID: 18093093
  17. Analysis of specific residues in these conserved ABC motifs within MsbA indicates that closure of the dimer interface does not occur upon ATP binding in this transporter. PMID: 19053284
  18. MsbA can act as a multidrug transporter, consistent with its structural similarities with the human multidrug resistance P-glycoprotein ABCB1, and transmembrane helix 6 plays a critical role in the binding and transport of multiple drugs. PMID: 18803398

Show More

Hide All

Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MsbA and what is its primary function in E. coli?

MsbA is an essential 65 kDa membrane protein belonging to the ABC (ATP-binding-cassette) superfamily in Gram-negative bacteria. It functions primarily as a homodimeric ATP-dependent lipid translocase or flippase that transports lipid A from the inner to the outer leaflet of the cytoplasmic membrane. This transport function is critical for the assembly of the outer membrane, as lipid A serves as the hydrophobic anchor for lipopolysaccharide (LPS) in the outer leaflet of the outer membrane. The essential nature of MsbA is likely due to its role in mediating this crucial step in LPS biogenesis .

How is MsbA structurally organized in the bacterial membrane?

MsbA exists as a homodimer embedded in the inner membrane of E. coli, with each monomer containing six transmembrane helices and a cytosolic ATP-binding domain. This structural organization is typical of ABC transporters, with the transmembrane domains forming the translocation pathway and the nucleotide-binding domains providing the energy for transport through ATP hydrolysis. Crystal structures of MsbA have been obtained, making it the first ABC efflux system for which high-resolution structures became available . The transmembrane domains are arranged to create a central cavity that accommodates various lipid substrates, while conformational changes driven by ATP binding and hydrolysis facilitate the translocation process.

What evidence supports MsbA's role in lipid A transport?

Multiple lines of evidence support MsbA's role in lipid A transport. First, mutations in MsbA result in cytoplasmic membrane accumulation of lipopolysaccharides, lipid A, and its derivatives. Second, in cells expressing missense MsbA mutants, phosphatidylethanolamine (PE) and lipid A are accessible from the cytoplasmic face of the membrane rather than the periplasmic face, consistent with a block in translocation. Third, temperature-sensitive MsbA mutants like WD2 (with the A270T substitution) synthesize hexa-acylated lipid A at non-permissive temperatures, but these molecules accumulate on the inner surface of the inner membrane, as demonstrated by their inaccessibility to modification enzymes like LpxE . Collectively, these findings provide strong evidence that MsbA functions in translocating lipid A across the inner membrane.

Does MsbA exclusively transport lipid A, or does it have broader substrate specificity?

Research demonstrates that MsbA has broader substrate specificity beyond lipid A. Purified and functionally active MsbA reconstituted into proteoliposomes displays flippase activity for various fluorescently NBD-labelled phospholipid species, including both headgroup- and acyl chain-labelled derivatives of phosphatidylethanolamine (PE) and phosphatidylserine (PS), as well as chain-labelled phosphatidylglycerol (PG), phosphatidylcholine (PC), and sphingomyelin (SM) . Additionally, MsbA has been shown to interact with multiple drugs. When expressed in Lactococcus lactis (which lacks LPS), MsbA conferred an 86-fold increase in resistance to the macrolide erythromycin and demonstrated transport activity for ethidium and Hoechst 33342 . These findings indicate that MsbA has a broader substrate specificity than initially thought, functioning both as a lipid translocase and potentially as a multidrug transporter.

How is MsbA's ATPase activity regulated by lipid interactions?

MsbA's ATPase activity is modulated by various lipids and lipid-based molecules. Direct binding studies using intrinsic tryptophan fluorescence quenching have shown that MsbA binds to lipid A, LPS precursors (RaLPS and ReLPS), and phospholipid-based amphipathic drugs with affinities in the low micromolar range . These interactions affect the protein's ATPase activity, suggesting a regulatory mechanism tied to substrate binding. The highest rates of flippase activity are observed when MsbA is reconstituted into an E. coli lipid mixture, indicating that the native lipid environment optimizes the protein's function . Additionally, free lipid A demonstrates noncompetitive inhibition of Hoechst 33342 transport with a Ki of 57 μM, in a similar range as the Ki for vinblastine (a known inhibitor), suggesting specific regulatory interactions between lipid A and MsbA that impact its transport activities .

What is the relationship between MsbA and other components of the LPS transport pathway?

MsbA represents the first step in the multi-component LPS transport pathway. After MsbA flips core-lipid A to the outer leaflet of the inner membrane, additional proteins facilitate its transport to the outer membrane. These include the periplasmic protein LptA, the cytosolic protein LptB, and the inner membrane proteins LptC, LptF, and LptG, which constitute a second ABC transporter complex with accessory proteins. At the outer membrane, the LptD/LptE complex ultimately flips LPS to the outer surface . Temperature-sensitive mutants of LptA (like MB1 with S22C and Q111P substitutions) show defective LPS export, with core-lipid A reaching the periplasmic side of the inner membrane but not the outer surface of the outer membrane at non-permissive temperatures . This indicates that MsbA functions specifically in the inner membrane flipping step, while the subsequent transport across the periplasm and to the outer membrane requires the coordinated action of the Lpt proteins.

How can functional MsbA be purified and reconstituted for in vitro studies?

For functional studies of MsbA, researchers typically express His6-tagged wild-type MsbA in E. coli, followed by purification and reconstitution into proteoliposomes. A successful reconstitution system involves the following methodology:

  • Overexpression of His6-tagged MsbA in E. coli

  • Membrane isolation and solubilization using appropriate detergents

  • Affinity purification of the tagged protein

  • Reconstitution into proteoliposomes composed of E. coli lipids (optimal) or other defined lipid mixtures

The functionality of reconstituted MsbA can be assessed through ATPase activity measurements and lipid translocation assays. The protein shows the highest rates of flippase activity when reconstituted into an E. coli lipid mixture, suggesting that the native lipid environment is important for optimal function . Importantly, the lipid-to-protein ratio is critical, as previous studies failed to demonstrate MsbA-mediated phospholipid flipping at a ratio of E. coli lipid/MsbA of approximately 10:1 (w/w) . This highlights the importance of reconstitution conditions in preserving MsbA's functional properties.

What assays can be used to measure MsbA-mediated lipid translocation?

Several complementary assays have been developed to measure MsbA-mediated lipid translocation:

  • Fluorescent NBD-labeled lipid assays: This approach uses fluorescently NBD (7-nitrobenz-2-oxa-1,3-diazole)-labeled lipid species. After reconstitution of MsbA with these fluorescent lipids, translocation can be monitored by measuring changes in fluorescence intensity or by using dithionite quenching to distinguish between lipids in the inner and outer leaflets of the membrane .

  • Enzymatic modification assays: This approach leverages enzymes that modify specific positions on lipid A. For example, LpxE (lipid A 1-phosphatase) can be used as a periplasmic inner membrane marker, while PagL (lipid A 3-O-deacylase) serves as an outer membrane marker. The accessibility of these enzymes to their respective substrates indicates the orientation and localization of lipid A .

  • Drug transport assays: For studying MsbA's interaction with drugs, researchers have measured the transport of fluorescent substrates like ethidium and Hoechst 33342. These assays can reveal kinetic parameters and allow the characterization of inhibitors through competition studies .

  • ATP hydrolysis assays: Since MsbA is an ATP-dependent transporter, measuring ATP hydrolysis rates in the presence of different lipids or drugs can provide insights into substrate interactions and transport mechanisms .

How can genetic approaches be used to study MsbA function in vivo?

Genetic approaches offer powerful tools for studying MsbA function in vivo:

  • Temperature-sensitive mutants: Mutants like WD2 (with the A270T substitution in MsbA) allow controlled inactivation of the protein by temperature shifts. These mutants synthesize hexa-acylated lipid A at non-permissive temperatures, but the molecules accumulate on the inner surface of the inner membrane .

  • Heterologous expression systems: Expressing MsbA in organisms like Lactococcus lactis, which lacks LPS, enables the study of MsbA's drug transport functions in an environment deficient in its native lipid A substrate. This approach revealed MsbA's ability to confer resistance to erythromycin and transport various drugs, supporting its multidrug transporter capabilities .

  • Complementation studies: The essential nature of MsbA makes direct gene knockout challenging. Instead, researchers can replace the chromosomal gene with a cassette while providing a plasmid-encoded wild-type or mutant version in trans. This approach has been successfully used to study LptA and LptB mutants and could be applied to MsbA .

  • Conditional expression systems: Placing MsbA under the control of inducible promoters allows for controlled depletion studies, revealing the consequences of MsbA deficiency over time.

What temperature-sensitive MsbA mutants have been characterized, and how do they affect lipid transport?

The WD2 mutant, harboring the A270T substitution in MsbA, is a well-characterized temperature-sensitive mutant. At non-permissive temperatures (42°C), WD2 continues to synthesize hexa-acylated lipid A for approximately 1 hour, but these molecules accumulate on the inner surface of the inner membrane. This accumulation is evidenced by the inaccessibility of lipid A to modification enzymes like LpxE, which acts on the periplasmic side of the inner membrane . The temperature-sensitive phenotype allows researchers to precisely control MsbA function through temperature shifts, providing a valuable tool for studying the consequences of MsbA inactivation without the need for gene deletion, which would be lethal due to MsbA's essential nature.

How do mutations in MsbA affect drug resistance in bacteria?

Mutations in MsbA can significantly impact drug resistance in bacteria. When wild-type MsbA from E. coli was expressed in Lactococcus lactis, it conferred an 86-fold increase in resistance to the macrolide erythromycin, demonstrating MsbA's ability to function as a multidrug transporter . The kinetic characterization of MsbA-mediated ethidium and Hoechst 33342 transport revealed apparent single-site kinetics and competitive inhibition by vinblastine with Ki values of 16 and 11 μM, respectively . These findings suggest that specific mutations in MsbA could potentially alter drug binding sites or transport efficiency, thereby modifying bacterial resistance to various antimicrobials. Understanding these structure-function relationships could inform strategies to overcome antibiotic resistance or develop inhibitors targeting MsbA.

What insights have been gained from studying MsbA structure through crystallography?

MsbA was the first ABC efflux system for which high-resolution crystal structures were obtained, providing crucial insights into its mechanism of action . The crystal structure of MsbA from Salmonella enterica serovar Typhimurium revealed direct LPS-MsbA interactions, supporting the functional data indicating MsbA's role in LPS transport . These structural studies have shown that MsbA forms a homodimer with each monomer containing six transmembrane helices and a cytosolic ATP-binding domain . The structural data have helped elucidate how conformational changes driven by ATP binding and hydrolysis facilitate substrate translocation across the membrane. Additionally, the structures provide a molecular framework for understanding how MsbA interacts with diverse substrates, including lipid A, phospholipids, and various drugs.

How does MsbA coordinate with other LPS transport machinery components?

While MsbA's role in flipping lipid A across the inner membrane is well-established, how it coordinates with other components of the LPS transport machinery remains an area of active investigation. After MsbA flips core-lipid A to the outer leaflet of the inner membrane, the LptA/B/C/F/G system facilitates its transport to the outer membrane, where the LptD/LptE complex ultimately flips LPS to the outer surface . Questions remain about how these systems communicate and coordinate their activities. Are there direct protein-protein interactions between MsbA and components of the Lpt system? Is there a signaling mechanism that ensures properly timed handoff of LPS from one system to the next? Additionally, the potential role of other accessory proteins in facilitating this coordination has not been fully explored. Future research using techniques like protein-protein interaction studies, co-immunoprecipitation, and high-resolution imaging could help elucidate these coordination mechanisms.

What are the implications of MsbA's dual role as a lipid transporter and multidrug transporter?

The discovery that MsbA can function both as a lipid transporter and as a multidrug transporter raises intriguing questions about its evolutionary history and physiological significance. Does this dual functionality reflect an ancient, broader substrate specificity that has been partially conserved? Or has MsbA evolved specifically to handle diverse substrates in response to environmental pressures? From a mechanistic perspective, how does MsbA accommodate such structurally diverse molecules within the same translocation pathway? Understanding these aspects could provide insights into the general principles of ABC transporter substrate recognition and transport.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.