Recombinant Escherichia coli Lipopolysaccharide biosynthesis protein wzzE (wzzE)

Shipped with Ice Packs
In Stock

Description

Protein Overview

WzzE belongs to the polysaccharide co-polymerase (PCP) family, specifically PCP-1a, and is essential for determining the modal length of ECA and O-antigen (Oag) polysaccharides . Recombinant WzzE is produced via heterologous expression systems (e.g., pQE30 vectors with His-tags) to study its biochemical and structural properties .

Functional Role in LPS/ECA Biosynthesis

WzzE operates in the Wzy-dependent pathway, collaborating with polymerase WzyE and flippase WzxE:

  • Chain Length Regulation: Controls ECA polymerization to 4–8 repeat units (RUs) and modulates Oag modal length in hybrid systems .

  • Mechanism: Proposed "ratchet" model where alternating L4 loops guide polysaccharide elongation, while TM domains interact with WzyE .

Table 2: Functional Interactions

Interaction PartnerRole in PathwayEffect of WzzE Activity
WzyEPolymerase for ECA chain elongationDetermines ECA modal length
WzxETranslocates lipid-linked oligosaccharidesEnables periplasmic polymerization
WzzB (Chimeras)TM domain swaps alter Oag polymerizationTM2 critical for WzyB interaction

Chimera Studies

Swapping TM domains between WzzE and WzzB revealed:

  • TM2 Determines Specificity: Replacing WzzE TM2 with WzzB TM2 enhanced Oag modal length control by 50%, suggesting TM2 mediates Wzy interactions .

  • Functional Cross-Complementation: WzzE partially restored Oag polymerization in wzzB mutants, altering LPS profiles and colicin E2 resistance .

Interaction Network

STRING analysis identifies WzzE’s functional partners in ECA biosynthesis :

  • wecA: Initiates ECA synthesis by transferring GlcNAc to undecaprenyl phosphate.

  • wzyE: Polymerizes ECA repeat units.

  • wzxE: Translocates lipid III intermediates.

Applications and Implications

  • Antimicrobial Targets: Disrupting WzzE-WzyE interactions could inhibit biofilm formation or virulence .

  • Biotechnology: Engineered WzzE chimeras enable controlled polysaccharide synthesis for glycoconjugate vaccines .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
wzzE; wzz; yifC; b3785; JW5601; ECA polysaccharide chain length modulation protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-348
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
wzzE
Target Protein Sequence
MTQPMPGKPAEDAENELDIRGLFRTLWAGKLWIIGMGLAFALIALAYTFFARQEWSSTAI TDRPTVNMLGGYYSQQQFLRNLDVRSNMASADQPSVMDEAYKEFVMQLASWDTRREFWLQ TDYYKQRMVGNSKADAALLDEMINNIQFIPGDFTRAVNDSVKLIAETAPDANNLLRQYVA FASQRAASHLNDELKGAWAARTIQMKAQVKRQEEVAKAIYDRRMNSIEQALKIAEQHNIS RSATDVPAEELPDSEMFLLGRPMLQARLENLQAVGPAFDLDYDQNRAMLNTLNVGPTLDP RFQTYRYLRTPEEPVKRDSPRRAFLMIMWGIVGGLIGAGVALTRRCSK
Uniprot No.

Target Background

Function
This protein modulates the polysaccharide chain length of enterobacterial common antigen (ECA). It is essential for the assembly of both the phosphoglyceride-linked form of ECA (ECA(PG)) and the water-soluble cyclic form of ECA (ECA(CYC)).
Gene References Into Functions
  1. WzzE is not involved in lipopolysaccharide synthesis but plays a role in the pathogenic process. PMID: 29727150
  2. E. coli WzzB and WzzE polysaccharide copolymerases form octameric homo-oligomeric complexes. PMID: 25307743
  3. Studies suggest that the coiled-coil regions are crucial for Wzz function, maintaining the protein's native conformation, although experimental confirmation of coiled-coil presence remains inconclusive. PMID: 18203821
Database Links
Protein Families
WzzB/Cld/Rol family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the key specifications of recombinant wzzE protein for research applications?

The recombinant Escherichia coli Lipopolysaccharide biosynthesis protein wzzE has the following specifications:

ParameterSpecification
Product CodeCSB-EP365386ENV1
Uniprot No.P0AG00
Product TypeRecombinant Protein
Immunogen SpeciesEscherichia coli (strain K12)
Purity>85% (SDS-PAGE)
SourceE.coli
Protein LengthPartial

Researchers should verify these specifications when designing experiments to ensure compatibility with their research objectives and methodological requirements .

What are the optimal storage conditions for recombinant wzzE protein?

Storage conditions significantly impact protein stability and experimental reproducibility. The following conditions are recommended:

Storage FormRecommended TemperatureExpected Shelf Life
Liquid form-20°C/-80°C6 months
Lyophilized form-20°C/-80°C12 months
Working aliquots4°CUp to one week

Methodologically, it is critical to avoid repeated freeze-thaw cycles which can compromise protein integrity. Implementing a single-use aliquot system is recommended for maintaining consistent protein quality across experiments .

What is the recommended reconstitution protocol for recombinant wzzE protein?

For optimal reconstitution and experimental consistency:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (default recommendation is 50%)

  • Prepare aliquots for long-term storage at -20°C/-80°C

This methodological approach minimizes protein degradation and maintains consistency across experimental replicates. Researchers should document reconstitution conditions in their laboratory records to ensure reproducibility .

How should researchers design controlled experiments to investigate wzzE protein function?

When investigating wzzE protein function, true experimental designs offer the strongest approach for establishing causal relationships. Key methodological considerations include:

Design ElementImplementation Strategy
Control vs. Experimental GroupsRandomly assign samples with and without wzzE treatment
Variable ManipulationSystematically vary wzzE concentration or conditions
RandomizationEnsure random distribution to minimize extraneous variables
ReplicationInclude both technical and biological replicates

These design elements are essential for controlling confounding variables and establishing clear causal relationships in wzzE functional studies. The experimental approach should include positive controls (wild-type systems) and negative controls (systems without wzzE) to provide comparative baseline data .

What variables must be defined when designing wzzE experimental studies?

Following established experimental design principles, researchers should clearly define:

Variable TypeDefinitionExamples for wzzE Research
Independent VariablesFactors manipulated by researcherwzzE concentration, temperature, pH, incubation time
Dependent VariablesMeasured outcomesLPS structure changes, downstream pathway activity
Extraneous VariablesUncontrolled factors affecting resultsBatch variations, environmental conditions
Control VariablesFactors held constantBuffer composition, cell density, experimental duration

Methodologically, each variable should be operationally defined in measurable terms, with established protocols for consistent measurement and documentation. This systematic approach ensures experimental validity and reproducibility .

What quasi-experimental designs are appropriate when randomization or control groups are not feasible?

In research scenarios where true experimental designs aren't feasible, quasi-experimental approaches may be valuable:

Quasi-Experimental DesignApplication to wzzE ResearchMethodological Considerations
One-Group Pretest-PosttestMeasure system before and after wzzE introductionControl for time-related confounds
Nonequivalent Control GroupCompare naturally occurring groups with and without wzzEDocument group differences
Time Series DesignMultiple measurements before and after wzzE interventionEstablish baseline stability

Researchers should acknowledge the limitations of quasi-experimental designs while implementing additional controls to strengthen internal validity. These approaches are particularly useful when studying complex biological systems where complete randomization is impractical .

How can researchers design experiments to analyze potential interaction effects between wzzE and other LPS biosynthesis proteins?

Advanced experimental designs for studying protein interactions require multifactorial approaches:

Interaction Analysis MethodMethodological Implementation
Factorial DesignSystematically vary levels of wzzE and other proteins
Response Surface MethodologyMap interaction effects across concentration gradients
Genetic Interaction AnalysisStudy double mutants to identify synthetic effects

Researchers should employ multiple complementary techniques to verify interaction effects and distinguish direct from indirect interactions. Statistical analysis should include tests for interaction terms in addition to main effects .

What experimental design considerations are important when studying wzzE under varying environmental conditions?

Environmental factors can significantly impact wzzE function, requiring:

Environmental FactorExperimental Design Approach
Temperature VariationBlocked design with temperature as controlled variable
pH ConditionsSystematic testing across physiologically relevant range
Ionic StrengthFactorial design with multiple salt concentrations
Oxygen AvailabilityParallel aerobic and anaerobic experimental conditions

Methodologically, researchers should implement appropriate controls for each environmental condition and consider potential interaction effects between environmental factors. This approach allows for comprehensive characterization of wzzE function across relevant physiological conditions .

How can single-case experimental designs be applied to specialized wzzE research questions?

For research involving rare variants or specialized conditions:

Single-Case DesignApplication to wzzE ResearchAnalytical Approach
A-B-A DesignEvaluate reversibility of wzzE effectsVisual analysis and statistical tests
Multiple BaselineStaggered introduction of wzzE across systemsTime-series analysis
Changing CriterionSystematic variation of wzzE concentration thresholdsLevel change assessment

These designs are particularly valuable for detailed mechanistic studies or when working with limited sample availability. Researchers should collect sufficient baseline data to establish stability before intervention and implement rigorous analytical approaches to detect treatment effects .

What statistical considerations are most important when analyzing data from wzzE experimental studies?

Rigorous statistical analysis is essential for valid interpretation of wzzE experimental data:

Statistical ConsiderationMethodological Approach
Sample Size DeterminationPower analysis based on expected effect size
Normality AssessmentShapiro-Wilk or similar tests prior to parametric analysis
Multiple ComparisonsAppropriate correction methods (Bonferroni, FDR)
Effect Size ReportingCohen's d, partial η², or other appropriate measures

Researchers should conduct preliminary tests of statistical assumptions and document their analytical approach comprehensively. Reporting both statistical significance and effect sizes provides a more complete understanding of experimental outcomes .

How should researchers address contradictory findings in wzzE functional studies?

When facing conflicting experimental results:

  • Systematically compare methodological differences between studies

  • Identify potential moderating variables that could explain discrepancies

  • Design critical experiments specifically targeting the contradictions

  • Consider meta-analytical approaches to integrate findings across studies

This methodological framework helps resolve apparent contradictions by identifying context-dependent effects or overlooked variables. Researchers should report contradictory findings transparently and provide reasoned interpretations based on systematic analysis .

How can Google's "People Also Ask" data inform research directions for wzzE studies?

Strategic use of Google's People Also Ask (PAA) data can enhance research planning:

PAA ApplicationResearch BenefitImplementation Approach
Identify Knowledge GapsDiscover frequently asked but unanswered questionsSystematic collection of PAA data for wzzE-related searches
Track Research TrendsMonitor evolving questions in the fieldPeriodic analysis of changing PAA patterns
Discover Related ConceptsIdentify connected research areasAnalysis of cascading question patterns

PAA data appears in over 80% of English searches, generally within the first few results, making it a valuable source of information about research interests and knowledge gaps in the field. Researchers can use this data to identify high-impact research questions and align their investigations with broader scientific interests .

What are the most effective experimental approaches for comparing wild-type and mutant forms of wzzE?

Comparative studies require careful methodological considerations:

Comparison ElementExperimental ApproachControl Measures
Expression LevelsQuantitative Western blotStandard curves with purified protein
Functional ActivityIn vitro assays with standardized conditionsParallel testing of both forms
Structural IntegrityCircular dichroism or thermal stability assaysMultiple analytical techniques
Interaction ProfilesCo-immunoprecipitation or pull-down assaysReciprocal tagging approaches

Researchers should ensure that both wild-type and mutant proteins are prepared using identical methods, with verification of comparable purity (>85% as specified for the recombinant protein). This methodological consistency is essential for valid comparative analyses .

How should researchers design experiments to elucidate the specific role of wzzE in lipopolysaccharide chain length determination?

To investigate the chain length regulatory function:

Experimental ApproachMethodological ConsiderationsExpected Outcomes
Complementation StudiesIntroduction of wzzE into knockout strainsRestoration of wild-type LPS patterns
Concentration-Dependent AssaysTitration of wzzE protein levelsDose-response in chain length distribution
Structure-Function AnalysisTargeted mutagenesis of functional domainsIdentification of critical residues

These approaches should be implemented with appropriate controls and replication to establish the specific mechanisms by which wzzE influences LPS biosynthesis. Researchers should employ multiple analytical techniques to characterize LPS profiles and correlate them with wzzE activity levels .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.