Recombinant Escherichia coli Lipopolysaccharide export system permease protein lptF (lptF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Avoid repeated freezing and thawing. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize its development.
Synonyms
lptF; yjgP; b4261; JW4218; Lipopolysaccharide export system permease protein LptF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-366
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
lptF
Target Protein Sequence
MIIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGDIPANLVLSLLGLGVPEMA QLILPLSLFLGLLMTLGKLYTESEITVMHACGLSKAVLVKAAMILAVFTAIVAAVNVMWA GPWSSRHQDEVLAEAKANPGMAALAQGQFQQATNGSSVLFIESVDGSDFKDVFLAQIRPK GNARPSVVVADSGHLTQLRDGSQVVTLNQGTRFEGTALLRDFRITDFQDYQAIIGHQAVA LDPNDTDQMDMRTLWNTDTDRARAELNWRITLVFTVFMMALMVVPLSVVNPRQGRVLSML PAMLLYLLFFLIQTSLKSNGGKGKLDPTLWMWTVNLIYLALAIVLNLWDTVPVRRLRASF SRKGAV
Uniprot No.

Target Background

Function
This protein is part of the ABC transporter complex LptBFG, which plays a critical role in the translocation of lipopolysaccharide (LPS) from the inner membrane to the outer membrane of Escherichia coli.
Database Links
Protein Families
LptF/LptG family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of LptF in Escherichia coli?

LptF is a critical component of the lipopolysaccharide (LPS) transport machinery in Escherichia coli. It functions as a permease protein within the LptB2FG complex, an ABC transporter that extracts LPS from the inner membrane and initiates the transport process to the outer membrane. This process is essential for maintaining the asymmetry and barrier function of the Gram-negative bacterial envelope. The protein has been identified in genomic studies as one of several genes susceptible to mutations during recombineering processes, appearing among fixed mutations in certain experimental conditions . Understanding LptF's function requires recognizing its role within the broader LPS transport pathway, where it works in conjunction with other Lpt proteins (LptA, LptB, LptC, LptD, LptE, and LptG) to facilitate the movement of LPS molecules across the periplasmic space.

What structural features characterize LptF and how do they relate to its function?

LptF contains multiple transmembrane domains that anchor it in the inner membrane of E. coli, with periplasmic domains that interact with other components of the LPS transport system. The protein's structural arrangement creates a channel or pathway through which LPS molecules can be transported from the inner to the outer membrane. Research has shown that specific domains of LptF are critical for proper protein folding and complex assembly. The periplasmic domain of LptF adopts a β-jellyroll fold similar to other Lpt proteins, facilitating the formation of a continuous hydrophobic groove that guides LPS molecules across the periplasm. Mutations in lptF, as observed in recombineering experiments, can significantly impact bacterial physiology by disrupting this essential transport system . Researchers studying LptF structure should consider employing techniques like X-ray crystallography, cryo-electron microscopy, or molecular dynamics simulations to further elucidate the protein's structural features and mechanical properties.

How does LptF interact with other components of the LPS transport system?

LptF forms a heterodimeric complex with LptG in the inner membrane, which associates with two copies of the ATPase LptB to form the LptB2FG complex. This complex extracts LPS molecules from the inner membrane using energy derived from ATP hydrolysis by LptB. After extraction, LPS molecules are transferred to LptC and then to LptA, which forms a protein bridge across the periplasm to deliver LPS to the LptDE complex in the outer membrane. The interaction between LptF and other components occurs through β-jellyroll domains that create a continuous hydrophobic path for LPS transport. These interactions are critical for the proper functioning of the entire transport system. Mutations in lptF can disrupt these protein-protein interactions, potentially leading to defects in LPS transport and compromised membrane integrity, as indicated by studies involving genomic mutations in E. coli strains .

What are the most effective methods for expressing and purifying recombinant LptF?

Expressing and purifying membrane proteins like LptF presents significant challenges due to their hydrophobic nature. For optimal expression of recombinant LptF, researchers should consider these methodological approaches:

  • Expression Systems:

    • E. coli-based expression systems like BL21(DE3) or C43(DE3) strains (specifically designed for membrane proteins)

    • Use of pET vectors with inducible T7 promoters for controlled expression

    • Expression at lower temperatures (16-20°C) to facilitate proper folding

  • Purification Strategy:

    • Extraction using mild detergents (DDM, LDAO, or C12E8) to solubilize membrane proteins

    • Immobilized metal affinity chromatography (IMAC) using histidine tags

    • Size exclusion chromatography to further purify protein complexes

When working with LptF, it's crucial to verify protein integrity through methods such as circular dichroism or limited proteolysis to ensure the purified protein maintains its native conformation. Additionally, researchers should be aware of potential off-target effects introduced during genetic manipulation, as studies have shown that recombineering processes can introduce unintended mutations in other genes that might affect phenotypic analysis .

How can researchers generate targeted mutations in the lptF gene?

Generating precise mutations in lptF requires careful selection of genetic engineering techniques. Based on recent research, several approaches can be employed:

  • pORTMAGE Recombineering:

    • This technique employs a plasmid-based system for incorporating point mutations into bacterial genomes

    • Utilizes a dominant-negative mutL allele that temporarily limits DNA repair during oligonucleotide integration

    • Combines this with λ Red recombinase to facilitate the incorporation of synthetic oligonucleotides

To minimize such effects, researchers should:

  • Design highly specific oligonucleotides

  • Perform whole-genome sequencing to identify any off-target mutations

  • Create multiple independent mutants to verify phenotypes

  • Complement mutations to confirm their role in observed phenotypes

After recombineering, the plasmid should be cured by serial plating on non-selective media. Complete plasmid removal typically requires 1-2 overnight platings as demonstrated in recent protocols .

What considerations should be made when designing experiments to study LptF function?

When designing experiments to study LptF function, researchers should address several critical factors:

  • Genetic Background Considerations:

    • Use of well-characterized E. coli strains with complete genome sequences

    • Awareness that recombineering techniques can introduce unintended mutations

    • Implementation of proper controls to account for strain-specific variations

  • Phenotypic Analysis Methods:

    • Membrane permeability assays (using dyes like NPN or PI)

    • LPS transport assays using labeled LPS molecules

    • Antibiotic susceptibility testing, especially for compounds targeting outer membrane

  • Off-Target Effect Mitigation:

    • Whole genome sequencing of engineered strains to identify all genetic changes

    • Creation of revertant strains to confirm phenotype causality

    • Multiple independent mutants to distinguish specific from non-specific effects

Recent research has demonstrated the importance of reporting all genetic variants in mutant strains. Studies showed that several off-site mutations at high frequency and heterogeneous low-frequency mutations can occur during the recombineering process . This genetic heterogeneity can significantly impact subsequent phenotypic analyses, potentially leading to misattribution of phenotypes to the target mutation when they might be caused by off-target changes.

How do mutations in lptF affect LPS transport and bacterial membrane integrity?

Mutations in lptF can have profound effects on LPS transport and membrane integrity through several mechanisms:

  • Transport Efficiency Disruption:

    • Point mutations may alter the conformation of the LptB2FG complex

    • Changes in the periplasmic domain can disrupt the continuous hydrophobic path for LPS

    • ATPase activity coupling may be compromised, reducing transport energy efficiency

  • Membrane Integrity Effects:

    • Reduced LPS transport typically leads to asymmetric LPS distribution

    • Altered outer membrane permeability to hydrophobic compounds

    • Increased susceptibility to antibiotics that target Gram-negative bacteria

Research has shown that when introducing mutations into bacterial genomes using techniques like pORTMAGE recombineering, lptF can be susceptible to off-target mutations . These mutations can have significant phenotypic consequences, potentially confounding experimental interpretations if not properly identified. For example, in a study of recombineered E. coli strains, researchers found that the L329P mutant carried mutations to fixation in multiple genes including lptF . Such findings underscore the importance of comprehensive genetic analysis following any recombineering process.

When studying lptF mutations, researchers should implement both structural and functional assays, including membrane permeability tests, antibiotic susceptibility profiles, and direct measurement of LPS transport rates to fully characterize the phenotypic impact.

What approaches can be used to study the molecular mechanism of LptF-mediated LPS extraction?

Investigating the molecular mechanism of LptF-mediated LPS extraction requires sophisticated biophysical and biochemical approaches:

  • Structural Analysis Techniques:

    • X-ray crystallography of the LptB2FG complex in different conformational states

    • Cryo-electron microscopy to capture dynamic transport intermediates

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes

  • Functional Biochemistry Methods:

    • Reconstitution of purified LptB2FG complex into proteoliposomes

    • ATPase activity assays coupled to LPS extraction

    • Site-directed spin labeling and electron paramagnetic resonance (EPR) spectroscopy

  • Computational Approaches:

    • Molecular dynamics simulations of LPS-LptF interactions

    • Elastic network modeling of conformational changes

    • Quantum mechanics/molecular mechanics studies of the ATP hydrolysis coupling

When implementing these approaches, researchers should be mindful of the potential for off-target effects in genetically modified systems. Studies have demonstrated that recombineering techniques can introduce mutations beyond the target gene . For instance, whole genome sequencing of recombineered clones revealed that populations carried many low-frequency mutations—in one case, a single mutant carried 8 mutations above a frequency of 0.1 and 120 mutations below this threshold . This genetic heterogeneity could impact the interpretation of mechanistic studies if not properly accounted for.

How can researchers investigate LptF topology and membrane insertion dynamics?

Understanding LptF topology and membrane insertion dynamics requires specialized techniques:

  • Topology Mapping Methods:

    • Cysteine accessibility scanning with membrane-permeable and impermeable reagents

    • Fusion reporter systems (PhoA/LacZ) to identify periplasmic/cytoplasmic domains

    • Protease protection assays to determine exposed regions

  • Membrane Insertion Analysis:

    • In vitro translation systems coupled with membrane insertion assays

    • Fluorescence resonance energy transfer (FRET) to monitor assembly dynamics

    • Pulse-chase experiments to track protein maturation and complex formation

  • Dynamic Structural Studies:

    • Single-molecule FRET to observe conformational changes during transport

    • High-speed atomic force microscopy to visualize structural dynamics

    • Mass photometry to analyze complex assembly in native-like environments

Researchers should recognize that genetic manipulation techniques used to create reporter fusions or introduce mutations may lead to off-target effects. Studies have shown that even supposedly precise techniques like pORTMAGE recombineering can introduce unintended genetic changes . For example, sequencing of recombineered clones revealed both common and unique mutations across different strains, with some mutations appearing in genes far from the target site . These findings highlight the importance of comprehensive genetic verification when studying membrane protein topology and dynamics.

What recombineering approaches are most suitable for introducing precise mutations into lptF?

When selecting recombineering approaches for lptF modification, researchers should consider:

  • pORTMAGE Recombineering System:

    • Utilizes plasmid-based expression of λ Red recombinase and dominant-negative mutL

    • Allows for efficient oligonucleotide-directed mutagenesis

    • Temporarily increases mutation rate during oligonucleotide integration

    • Enables relatively quick plasmid curing (1-2 overnight platings)

  • CRISPR-Cas9 Assisted Recombineering:

    • Combines λ Red recombineering with CRISPR-Cas9 selection

    • Provides higher efficiency for marker-free mutations

    • Reduces off-target effects through precise targeting

    • Enables multiplexed genome editing

  • Scarless Genome Editing Approaches:

    • Two-step selection/counterselection systems (e.g., SacB/sucrose)

    • Landing pad technologies for precise genetic replacement

    • Recombinase-based systems for site-specific modifications

While pORTMAGE has been claimed to essentially eliminate off-target effects, recent research contradicts this assertion. Studies have shown that all populations harboring pORTMAGE carried a specific 1-bp deletion in hsdS, and mutant populations contained additional novel mutations that reached fixation . This genetic heterogeneity must be considered when attributing phenotypes to specific lptF mutations.

Recombineering MethodEfficiencyOff-target EffectsTime RequiredMarker Requirement
Standard λ RedModerateHigh3-5 daysUsually required
pORTMAGEHighPresent despite claims 2-4 daysNot required
CRISPR-Cas9Very highLower4-7 daysNot required
Two-step selectionModerateLow7-10 daysTemporary

How can researchers minimize and detect off-target effects when engineering lptF mutations?

Minimizing and detecting off-target effects is crucial when engineering lptF mutations:

  • Minimization Strategies:

    • Optimize oligonucleotide design for maximum specificity

    • Limit expression time of recombination proteins

    • Use the minimum effective concentration of mutagenic oligonucleotides

    • Employ enhanced fidelity variants of recombination proteins

  • Detection Methods:

    • Whole genome sequencing of mutant strains

    • Comparative genomic analysis with control strains

    • Low-frequency variant detection through deep sequencing

    • Phenotypic analysis of multiple independent mutants

Recent research has revealed the extent of off-target effects in recombineering systems. Studies found that in addition to a common mutation in hsdS across all strains that harbored pORTMAGE, each recombineered clone carried unique selective sweeps. For example, the L329P mutant contained four mutations that reached fixation in ecpC, ydcF, ptrB, and lptF . Furthermore, analysis of low-frequency mutations showed substantial heterogeneity, with populations carrying dozens to hundreds of mutations at frequencies below 0.1 .

The table below summarizes the typical mutation profiles observed in recombineered populations:

Mutant TypeMutations at f>0.1Mutations at f<0.1Common Mutations
R15L mutant997hsdS deletion
T14P mutant6102hsdS deletion
L329P mutant8120hsdS deletion
Control WT + pORTMAGE345hsdS deletion
WT (cured)3-451-55None specific

These findings emphasize the importance of comprehensive genetic verification when attributing phenotypes to specific lptF mutations .

What methods should be used to verify successful lptF mutations following recombineering?

Verification of lptF mutations requires a multi-faceted approach:

  • Initial Screening Methods:

    • PCR amplification and Sanger sequencing of the lptF region

    • Restriction enzyme digestion if the mutation creates/removes sites

    • Allele-specific PCR for rapid screening of multiple colonies

    • Mismatch cleavage assays (T7E1, Surveyor nuclease)

  • Comprehensive Verification:

    • Whole genome sequencing to identify all genetic changes

    • Analysis of variant frequencies in the population

    • Comparative genomics with parent strains

    • Targeted deep sequencing of potential off-target sites

  • Functional Validation:

    • Phenotypic assays to confirm expected functional changes

    • Complementation studies with wild-type lptF

    • Construction of revertant strains

    • Creation of multiple independent mutants

Research has shown that verification solely of the target mutation is insufficient. In a study using pORTMAGE recombineering, researchers found that despite confirming the intended mutations, whole genome sequencing revealed numerous off-target effects. These included both high-frequency mutations that reached fixation and heterogeneous low-frequency mutations that could potentially be selected during subsequent phenotypic studies .

The researchers emphasized that "it is important that future phenotypic studies using genomic engineering techniques acknowledge the heterogeneity when reporting novel phenotypes and that the genetic background could be contributing to their observations" . They further recommended that "studies that employ genome engineering should consistently verify and report the changes that result from whole genome resequencing rather than only confirming the presence of intended mutations" .

What assays can be used to measure LptF-dependent LPS transport activity?

Measuring LptF-dependent LPS transport activity requires specialized assays:

  • In Vivo Transport Assays:

    • Radiolabeled or fluorescently labeled LPS pulse-chase experiments

    • Surface accessibility assays using LPS-specific antibodies or bacteriophages

    • Cellular fractionation followed by LPS quantification in different compartments

    • Genetic reporter systems fused to LPS-responsive elements

  • In Vitro Reconstituted Systems:

    • Proteoliposome-based transport assays with purified components

    • Surface plasmon resonance to measure LPS-protein interactions

    • FRET-based assays to monitor LPS movement between membrane mimetics

    • ATPase activity coupled assays to link energy consumption to transport

  • Structural Transition Monitoring:

    • EPR spectroscopy with site-directed spin labeling

    • Hydrogen-deuterium exchange mass spectrometry

    • Single-molecule FRET to observe conformational changes during transport

When interpreting results from these assays in genetically modified strains, researchers must consider the potential impact of off-target mutations. Studies have shown that recombineering techniques can introduce unintended genetic changes that might affect observed phenotypes . Proper controls, including multiple independent mutants and complementation assays, are essential for attributing phenotypes specifically to lptF modifications.

How can researchers assess the impact of lptF mutations on bacterial physiology?

Assessing the physiological impact of lptF mutations requires a multi-parameter approach:

  • Membrane Integrity Assays:

    • Outer membrane permeability (using NPN, ANS, or PI uptake)

    • Detergent sensitivity (SDS, EDTA, deoxycholate resistance)

    • Electron microscopy to visualize membrane ultrastructure

    • Atomic force microscopy to measure mechanical properties

  • Antibiotic Susceptibility Profiles:

    • Minimum inhibitory concentration determination

    • Time-kill kinetics for membrane-targeting antibiotics

    • Synergy testing with outer membrane permeabilizers

    • Population analysis profiling for heteroresistance

  • Global Response Analysis:

    • Transcriptomics to identify stress responses

    • Proteomics focusing on envelope proteins

    • Metabolomics to detect changes in lipid composition

    • Phenotype microarrays for comprehensive growth condition testing

When conducting these analyses on recombineered strains, researchers should be aware that off-target mutations may contribute to observed phenotypes. In a study of pORTMAGE-generated mutants, researchers observed that each engineered strain carried unique mutations beyond the target site . They emphasized that "it is important that future phenotypic studies using genomic engineering techniques acknowledge the heterogeneity when reporting novel phenotypes and that the genetic background could be contributing to their observations" .

To address this challenge, researchers should implement appropriate controls, including the creation of revertant strains and complementation with wild-type lptF, to confirm that phenotypes are specifically attributable to lptF mutations rather than off-target effects.

What approaches are available for studying protein-protein interactions involving LptF?

Investigating protein-protein interactions involving LptF requires specialized techniques suitable for membrane proteins:

  • In Vivo Interaction Methods:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • In vivo photocrosslinking with unnatural amino acids

    • FRET/BRET assays with fluorescent protein fusions

    • Co-immunoprecipitation with mild detergent extraction

  • In Vitro Biochemical Approaches:

    • Native mass spectrometry of purified complexes

    • Surface plasmon resonance or bio-layer interferometry

    • Isothermal titration calorimetry for binding thermodynamics

    • Size exclusion chromatography coupled with multi-angle light scattering

  • Structural Characterization:

    • Cryo-electron microscopy of the LptB2FG complex

    • X-ray crystallography with stabilizing antibodies or nanobodies

    • Hydrogen-deuterium exchange to map interaction interfaces

    • Disulfide crosslinking to identify proximal residues

When employing genetic modifications to study these interactions, researchers should be cognizant of potential off-target effects that might affect interpretation. Recent research has demonstrated that even targeted recombineering techniques can introduce unintended mutations . For instance, whole genome sequencing of recombineered clones revealed both high-frequency mutations and heterogeneous low-frequency variants that could potentially confound interaction studies .

To mitigate these concerns, researchers should verify genetic backgrounds thoroughly and implement appropriate controls, including the use of multiple independent mutants and complementation studies, to ensure that observed interaction phenotypes are specifically attributable to the intended modifications in lptF.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.