Recombinant Escherichia coli Magnesium transport protein CorA (corA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Magnesium Transport Protein CorA (corA)

The Recombinant Escherichia coli Magnesium transport protein CorA (corA) is a genetically engineered version of the CorA protein, which is naturally found in bacteria like Escherichia coli. This protein plays a crucial role in the transport of magnesium ions (Mg²⁺) across cell membranes, facilitating both influx and efflux depending on cellular needs and environmental conditions . The recombinant form is produced through biotechnological methods, allowing for its use in research and potential applications in biotechnology and medicine.

Structure and Function of CorA

CorA is an integral membrane protein that functions as a homopentamer, meaning it consists of five identical subunits . Its structure includes a large periplasmic domain and three membrane-spanning segments in the C-terminal region, although earlier studies suggested only two transmembrane domains . The protein's mechanism involves initial selectivity at the periplasmic surface, where Mg²⁺ ions are dehydrated before being transported through the channel. The transport is regulated by intracellular Mg²⁺ levels; when these levels are low, the protein shifts to an open state, allowing Mg²⁺ influx .

Transport Kinetics and Selectivity

CorA exhibits specific transport kinetics for Mg²⁺ and other divalent cations like Co²⁺ and Ni²⁺. The kinetic parameters for Mg²⁺ transport include a Km (Michaelis constant) of about 15 μM and a Vmax (maximum velocity) of approximately 250 pmol/min per 10⁸ cells . The protein also transports Co²⁺ and Ni²⁺, but with different affinities and kinetic parameters. The selectivity of CorA for Mg²⁺ over other ions is crucial for maintaining cellular homeostasis and preventing metal toxicity .

IonKm (μM)Vmax (pmol/min/10⁸ cells)Ki (μM)
Mg²⁺15250-
Co²⁺3050050
Ni²⁺240360300

Biological Significance and Applications

The CorA protein is essential for bacterial viability, particularly in environments with low Mg²⁺ concentrations. For example, in Helicobacter pylori, CorA is crucial for survival in the gastric environment, which is characterized by low Mg²⁺ levels . The recombinant CorA protein can be used in research to study Mg²⁺ transport mechanisms and in biotechnological applications to enhance Mg²⁺ uptake in various organisms.

Production and Characteristics of Recombinant CorA

Recombinant CorA proteins are produced in host organisms such as E. coli, yeast, or mammalian cells. These proteins are typically purified to a high degree (>85%) and may include N-terminal or C-terminal tags for easier detection and purification . The molecular weight of the recombinant E. coli CorA is approximately 36,590 Da, and it is often stored in a lyophilized or liquid form at -20°C or -80°C for long-term preservation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
corA; b3816; JW3789; Magnesium transport protein CorA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
corA
Target Protein Sequence
MLSAFQLENNRLTRLEVEESQPLVNAVWIDLVEPDDDERLRVQSELGQSLATRPELEDIE ASARFFEDDDGLHIHSFFFFEDAEDHAGNSTVAFTIRDGRLFTLRERELPAFRLYRMRAR SQSMVDGNAYELLLDLFETKIEQLADEIENIYSDLEQLSRVIMEGHQGDEYDEALSTLAE LEDIGWKVRLCLMDTQRALNFLVRKARLPGGQLEQAREILRDIESLLPHNESLFQKVNFL MQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSFGYPGAIIFMI LAGLAPYLYFKRKNWL
Uniprot No.

Target Background

Function
This protein mediates the influx of magnesium ions and can also transport cobalt and manganese. It functions through alternating open and closed states, activated by low cytoplasmic Mg2+ levels and inactivated when cytoplasmic Mg2+ levels are high.
Gene References Into Functions
  1. Modulates cytoplasmic transition metal concentrations, influencing the lactoperoxidase sensitivity of E. coli by affecting the toxicity of the lactoperoxidase system. [PMID: 16269676]
  2. The periplasmic domain of the E. coli CorA protein functions as a homotetramer in substrate binding. [PMID: 16835234]
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the CorA magnesium transport protein?

The CorA protein exhibits a unique structural organization critical to its function as a magnesium transporter. In both Escherichia coli and Salmonella typhimurium, CorA consists of a large N-terminal periplasmic domain of approximately 235 amino acids, followed by a compact C-terminal domain of around 80 amino acids that forms three transmembrane (TM) segments . This unusual topology places the N-terminal domain in the periplasmic space while the C-terminus resides in the cytoplasm . Despite functioning as an integral membrane protein, CorA contains a surprisingly high proportion (28%) of charged amino acids . The protein's membrane topology indicates that a single CorA monomer possesses insufficient transmembrane segments to form a functional channel, suggesting that oligomerization is essential for transport activity.

How does CorA function as a magnesium transporter in bacterial cells?

CorA functions as a primary magnesium transporter in both Bacteria and Archaea, mediating both influx and efflux of magnesium ions across the cell membrane . The CorA system in Salmonella typhimurium and Escherichia coli consists of multiple components: the CorA protein itself is sufficient for magnesium influx, while products of the unlinked CorBCD loci enable CorA to additionally mediate efflux . The transport mechanism involves conformational changes in response to magnesium binding, with recent research suggesting that CorA exists in a dynamic equilibrium between different conducting and non-conducting states . This equilibrium shifts based on magnesium concentration, allowing the channel to respond to cellular magnesium requirements. The gating mechanism appears to involve asymmetric movements of monomers that enable rotation of specific helices and the cytoplasmic subdomain, forming new interactions that facilitate channel opening .

What is the oligomeric state of CorA and why is it important for function?

While there has been some debate in the literature regarding the oligomeric state of CorA, extensive experimental evidence supports that functional CorA exists as a homo-oligomer. Chemical cross-linking studies of intact cells and membranes, along with analysis of purified periplasmic soluble domains from both Salmonella Typhimurium and Methanococcus jannaschii, indicate that CorA forms a homotetramer . This oligomerization is functionally critical because a single CorA monomer with only three transmembrane segments is insufficient to form a functional channel or pore .

More recent studies using small-angle neutron scattering (SANS) and electron microscopy have suggested a pentameric architecture for CorA . The oligomeric structure creates a central pore through which magnesium ions can pass, with residues from multiple monomers contributing to the transport pathway. Site-directed mutagenesis studies have identified six intramembrane residues that form an apparent pore interacting with magnesium during transport, further supporting the importance of the quaternary structure for function .

What techniques are effective for analyzing the oligomeric state of CorA?

Several complementary techniques have proven valuable for determining the oligomeric state of membrane proteins like CorA:

  • Chemical Cross-linking: Formaldehyde treatment of intact cells and membranes containing CorA showed formation of a tetramer . This approach links adjacent protein subunits, allowing for analysis of oligomeric states by subsequent gel electrophoresis.

  • Site-directed Mutagenesis with Disulfide Formation Analysis: Introducing cysteine mutations at specific residues within the membrane domain can reveal proximity between monomers. In CorA, spontaneous disulfide bond formation between monomers carrying single intramembrane cysteine residues was observed, indicating close positioning of these residues across different monomers .

  • Electron Microscopy: Negative stain EM has been used to visualize the pentameric architecture of CorA in detergent micelles, with 2D class averaging and 3D model refinement confirming the oligomeric structure .

  • Small-angle Neutron Scattering (SANS): This technique provides information about the average conformation of CorA in solution under near-native conditions, allowing researchers to detect conformational changes with and without bound magnesium .

When employing these methods, researchers should consider using multiple approaches to confirm results, as each technique has inherent limitations. For instance, cross-linking may occasionally produce artifacts, while electron microscopy may not fully capture the protein's dynamic nature in solution.

How can researchers effectively express and purify recombinant CorA for structural and functional studies?

Successful expression and purification of recombinant CorA requires careful consideration of several factors:

  • Expression System Selection: The periplasmic soluble domains of CorA from both Salmonella Typhimurium and Methanococcus jannaschii have been successfully expressed using E. coli-based expression systems with pQE vectors (pQE-60 for M. jannaschii CorA-PPD and pQE-70 for Salmonella CorA-PPD) .

  • Fusion Tag Design: Including an enterokinase cleavage recognition sequence in the construct design facilitates tag removal after purification. The periplasmic domain constructs have been designed with SphI/NcoI restriction sites at the 5' end and BglII sites at the 3' end to facilitate cloning .

  • Membrane Localization Considerations: Since CorA is an integral membrane protein, its membrane localization is dependent on the Sec pathway in E. coli . Ensuring proper targeting signals are preserved in recombinant constructs is essential for correct folding and insertion.

  • Functional Verification: After purification, it's crucial to verify that the recombinant protein retains its native structure and function. Activity assays in proteoliposomes using fluorometric methods can confirm transport capability .

  • Buffer Optimization: For functional studies, researchers should note that CorA maintains activity in both H2O and D2O (with slightly reduced transport rates in D2O), which is relevant for neutron scattering experiments .

How do conformational changes regulate CorA magnesium transport activity?

CorA undergoes complex conformational changes that regulate its transport activity through a sophisticated gating mechanism:

  • Asymmetric Monomer Movements: Molecular dynamics simulations reveal pronounced asymmetric movements of CorA monomers that enable rotation of the α7 helix and the cytoplasmic subdomain . These movements facilitate the formation of new interactions that contribute to channel opening.

  • Conformational Equilibria: Rather than existing in two discrete states (open and closed), CorA appears to occupy a dynamic equilibrium between multiple conformational states . Small-angle neutron scattering (SANS) combined with molecular dynamics simulations and solid-state NMR spectroscopy indicates that neither the magnesium-bound closed structure nor the magnesium-free open forms fully explain the average conformation of CorA in solution .

  • State Populations: CorA likely exists in equilibrium between different non-conducting states (both symmetric and asymmetric) regardless of bound magnesium, but conducting states become more populated in magnesium-free conditions . This equilibrium is regulated by backbone dynamics that are key to understanding the functional regulation of the channel.

  • Intramolecular Interaction Networks: Computational studies validated by site-directed mutagenesis reveal a complex network of interactions that alter the structure of CorA to allow gating . These interactions involve residues in both the cytoplasmic domain and the transmembrane regions.

Understanding these conformational dynamics has practical implications for experimental design, as static structural models may not capture the full range of functionally relevant conformations.

What is known about the transmembrane domain organization of CorA and its role in ion selectivity?

The transmembrane domain of CorA plays a critical role in ion selectivity and transport:

  • Transmembrane Topology: Although initial hydropathy analysis predicted two C-terminal hydrophobic sequences long enough to span the membrane, experimental evidence using deletion derivatives fused to reporter proteins (BlaM or LacZ) indicates that CorA actually contains three membrane-spanning segments . This places the C-terminus in the cytoplasm, with the N-terminal domain located in the periplasmic space.

  • Pore-forming Residues: Mutagenesis studies have identified six intramembrane residues that form an apparent pore interacting with magnesium during transport . When these residues were mutated to cysteine, spontaneous disulfide bond formation occurred between monomers, indicating their close proximity in the assembled channel.

  • Inter-monomer Positioning: The transmembrane segments of adjacent monomers are arranged such that the same TM segment in different monomers can be physically close to one another . This arrangement creates the ion conduction pathway at the oligomer interface.

  • Hydration and Selectivity: Magnesium hydration plays a crucial role in CorA selectivity . This has important implications for experimental design, particularly when using deuterated solvents like D2O for neutron scattering experiments, as the physicochemical differences between H2O and D2O can affect transport rates.

How does magnesium concentration regulate CorA activity?

Magnesium concentration serves as the primary regulator of CorA activity through several mechanisms:

  • Conformational Control: Binding of magnesium ions to regulatory sites on CorA induces conformational changes that alter the channel between conducting and non-conducting states . Recent research suggests that rather than a simple open/closed binary system, CorA exists in a dynamic equilibrium between multiple conformational states, with the population distribution shifting based on magnesium availability .

  • Asymmetric Gating: Molecular dynamics simulations reveal that magnesium removal triggers pronounced asymmetric movements of monomers that enable rotation of the α7 helix and the cytoplasmic subdomain . These movements lead to the formation of new interactions and subsequent channel opening.

  • Dynamic Regulation: Small-angle neutron scattering (SANS) combined with molecular dynamics simulations and solid-state NMR spectroscopy has demonstrated variations in backbone dynamics with and without magnesium . These dynamic behaviors are key to understanding how CorA responds to changing magnesium levels.

  • Equilibrium Shift: In magnesium-free conditions, conducting states become more populated, but non-conducting states remain present in the conformational ensemble . This suggests a probabilistic rather than deterministic mechanism of regulation.

The regulatory mechanism has implications for experimental design, as interpreting functional data requires consideration of these complex conformational equilibria rather than simple binary states.

What experimental approaches can measure CorA-mediated magnesium transport in real-time?

Several techniques enable real-time monitoring of CorA-mediated magnesium transport:

  • Fluorometric Assays: These assays can measure CorA activity in reconstituted proteoliposomes, allowing determination of transport rates under various conditions . This approach has confirmed that CorA remains active in different solvent environments, including D2O (with slightly reduced transport rates compared to H2O).

  • Inhibitor-based Assays: Transport activity can be validated using selective inhibitors such as Co[NH3]6^3+, which blocks CorA-mediated magnesium transport . The differential response to inhibitors provides confirmation that observed signals represent specific CorA activity.

  • Electrophysiological Measurements: Patch-clamp techniques can be applied to measure ion currents through CorA channels, providing detailed information about conductance, ion selectivity, and gating kinetics.

  • Radioactive Tracer Flux: Using radioactive magnesium isotopes (e.g., ^28Mg) to trace flux across membranes containing CorA provides another quantitative approach to measuring transport activity.

When designing these experiments, researchers should consider that CorA transport rates may vary slightly between H2O and D2O environments, which is relevant when planning experiments that involve deuterated solvents for techniques like neutron scattering .

What are the key considerations for successful recombinant expression of functional CorA protein?

Successful recombinant expression of functional CorA requires addressing several critical factors:

  • Expression System Selection: E. coli has been successfully used as an expression host for both full-length CorA and its periplasmic soluble domains from various bacterial species, including Salmonella Typhimurium and Methanococcus jannaschii . The choice of expression vector is also important; pQE vectors (such as pQE-60 and pQE-70) have been successfully employed .

  • Targeting and Localization: Since CorA is an integral membrane protein dependent on the Sec pathway for membrane localization , proper signal sequences must be included in the expression construct to ensure correct targeting and insertion into the membrane.

  • Domain-specific Approaches: For structural studies of specific domains, expressing the periplasmic soluble domain (CorA-PPD) separately can be advantageous . These soluble constructs are generally easier to produce in high yields and retain structural features important for oligomerization.

  • Fusion Tags and Purification Strategies: Including affinity tags and protease cleavage sites in the construct design facilitates purification and subsequent tag removal. Enterokinase cleavage recognition sequences have been successfully incorporated into CorA constructs .

  • Detergent Selection for Membrane Protein Extraction: For full-length CorA, selecting appropriate detergents for extraction from the membrane is critical. Dodecyl maltoside (DDM) has been used successfully to maintain CorA in a functional state for structural studies .

  • Functional Verification: After expression and purification, it's essential to verify that the recombinant protein retains its native structure and function through methods such as negative stain electron microscopy to confirm oligomeric state and functional assays in reconstituted systems.

How can researchers troubleshoot common issues in CorA expression and purification?

Researchers may encounter several challenges when working with recombinant CorA. Here are strategies to address common issues:

  • Low Expression Levels:

    • Optimize growth conditions (temperature, media composition, induction timing)

    • Adjust codon usage for the expression host

    • Try different E. coli strains specialized for membrane protein expression

    • Consider using stronger or more tightly regulated promoters

  • Protein Aggregation or Misfolding:

    • Reduce expression temperature (e.g., 18-25°C instead of 37°C)

    • Co-express with molecular chaperones

    • Add osmolytes or stabilizing agents to the growth media

    • For membrane proteins, ensure proper membrane targeting by verifying signal sequences

  • Poor Membrane Extraction:

    • Screen multiple detergents and detergent concentrations

    • Optimize extraction conditions (time, temperature, buffer composition)

    • Consider using detergent mixtures or amphipols for stability

  • Oligomerization Issues:

    • Ensure buffer conditions support native oligomeric state

    • Verify oligomeric state using techniques like chemical cross-linking, size exclusion chromatography, or negative stain EM

    • Check for proper folding of domains critical for oligomerization

  • Loss of Function After Purification:

    • Reconstitute purified protein into liposomes to verify transport activity

    • Screen stabilizing conditions (specific ions, lipids, or stabilizing compounds)

    • Monitor protein stability during storage using techniques like dynamic light scattering

  • Protein Heterogeneity:

    • Implement additional purification steps targeting specific conformational states

    • Consider using nanobodies or other specific binding partners to stabilize particular conformations

How can molecular dynamics simulations enhance our understanding of CorA function?

Molecular dynamics (MD) simulations have become a powerful tool for investigating CorA function at the atomic level, complementing experimental approaches:

  • Conformational Dynamics Analysis: All-atom and coarse-grained MD simulations have revealed pronounced asymmetric movements of CorA monomers that enable rotation of key structural elements like the α7 helix and cytoplasmic subdomain . These simulations capture the dynamic nature of CorA better than static structural models.

  • Gating Mechanism Elucidation: MD simulations have helped reconcile various gating hypotheses for CorA by revealing the complex network of interactions that alter protein structure during channel opening . These computational results have been functionally validated using site-directed mutagenesis and biochemical assays.

  • Integration with Experimental Data: MD simulations can be combined with experimental techniques like small-angle neutron scattering (SANS) and solid-state NMR spectroscopy to develop more comprehensive models of CorA function . This integrative approach provides insights into conformational equilibria that may not be apparent from any single method.

  • Ion Permeation Pathway Mapping: Simulations can track the movement of magnesium ions through the channel, identifying key residues involved in ion coordination and selectivity. This information can guide future mutagenesis studies targeting specific aspects of transport.

  • Experimental Design Guidance: Insights from MD simulations can inform the design of experimental studies, suggesting specific residues for mutagenesis or conditions that might stabilize particular conformational states .

When implementing MD simulations for CorA research, it's important to validate computational predictions with experimental data and consider the limitations of current force fields in accurately representing ion-protein interactions.

What are the implications of CorA research for understanding related magnesium transporters in eukaryotes?

Research on bacterial CorA has significant implications for understanding related magnesium transporters in eukaryotes:

  • Evolutionary Conservation: The CorA family plays a housekeeping role in divalent metal ion homeostasis not only in bacteria and archaea but also in mitochondria of eukaryotes . This evolutionary conservation suggests fundamental mechanistic similarities across domains of life.

  • Structural Insights Transfer: Structural features identified in bacterial CorA can inform models of eukaryotic magnesium transporters, particularly those in mitochondria. The unique topology and oligomeric organization of CorA may represent a conserved architecture for magnesium transport .

  • Mechanistic Parallels: The conformational dynamics and magnesium-dependent gating mechanisms observed in bacterial CorA likely have parallels in eukaryotic systems . Understanding these mechanisms can provide insights into magnesium homeostasis in higher organisms.

  • Disease Relevance: Dysregulation of magnesium transport in humans is associated with various pathological conditions. Insights from CorA research may contribute to understanding these disorders and potentially inform therapeutic approaches .

  • Experimental Approach Translation: Methodologies developed for studying bacterial CorA, such as the combination of SANS, MD simulations, and NMR spectroscopy , can be adapted to investigate eukaryotic magnesium transporters, facilitating comparative studies across evolutionary diverse systems.

Researchers studying eukaryotic magnesium transporters should consider both the similarities and differences compared to bacterial CorA, recognizing that while core mechanisms may be conserved, regulatory aspects are likely to be more complex in eukaryotes.

What is the amino acid composition and key structural features of CorA?

Table 1: Key Features of E. coli and S. typhimurium CorA Proteins

FeatureE. coli CorAS. typhimurium CorAReference
Protein Length316 amino acids316 amino acids
Gel Molecular Mass39 kDa42 kDa
Charged Amino Acid Content~28%~28%
N-terminal Domain Size~235 amino acids~235 amino acids
C-terminal Domain Size~80 amino acids~80 amino acids
Transmembrane Segments33
Sequence Identity Between Species98%98%
Oligomeric StateHomotetramer or Homopentamer (disputed)Homotetramer or Homopentamer (disputed)
TopologyN-terminus in periplasm, C-terminus in cytoplasmN-terminus in periplasm, C-terminus in cytoplasm

The CorA proteins from E. coli and S. typhimurium are highly similar (98% sequence identity) and share an unusual topology with a large periplasmic domain and three transmembrane segments . Despite being integral membrane proteins, they contain a surprisingly high proportion of charged amino acids (28%) , which is atypical for membrane-spanning proteins and suggests specialized structural adaptations for ion transport.

How do transport rates of CorA differ under various experimental conditions?

Table 2: Comparative CorA Transport Activity Under Different Conditions

Experimental ConditionRelative Transport RateNotesReference
H2O (standard condition)100% (baseline)Standard reference condition
D2O>50% of H2O rateSlightly reduced rate compared to H2O
D2O + Co[NH3]6^3+ (inhibitor)NegligibleTransport effectively inhibited
Mg2+ present (regulatory sites)ReducedShift toward non-conducting conformational states
Mg2+ absentEnhancedShift toward conducting conformational states

These comparative transport rates highlight important considerations for experimental design when studying CorA. The protein maintains functionality in deuterated solvents (relevant for neutron scattering experiments), though with slightly reduced activity . The inhibition by Co[NH3]6^3+ provides a useful experimental control to confirm specific CorA-mediated transport . The regulation by magnesium binding to regulatory sites, shifting the conformational equilibrium between conducting and non-conducting states, represents a central aspect of CorA's physiological function .

What are the emerging techniques that could advance our understanding of CorA structure and function?

Several cutting-edge approaches show promise for advancing CorA research:

  • Cryo-Electron Microscopy (Cryo-EM): High-resolution cryo-EM could capture CorA in different conformational states under near-native conditions, potentially resolving debates about oligomeric state and providing insights into the dynamic aspects of channel gating .

  • Single-Molecule FRET: This technique could track real-time conformational changes in CorA in response to varying magnesium concentrations, offering insights into the kinetics and heterogeneity of these transitions at the single-molecule level.

  • Advanced Computational Methods: Enhanced sampling techniques and longer-timescale molecular dynamics simulations could further elucidate the conformational landscape of CorA and the energetics of transitions between different states .

  • Time-Resolved Structural Methods: Techniques like time-resolved X-ray crystallography or X-ray free-electron laser (XFEL) studies could potentially capture transient intermediate states during CorA gating.

  • Integrative Structural Biology: Combining multiple techniques such as SANS, NMR, cryo-EM, and computational modeling can provide more comprehensive models of CorA structure and dynamics than any single approach .

  • Native Mass Spectrometry: This emerging approach could provide definitive information about the oligomeric state and stability of CorA complexes under varying conditions, potentially resolving current debates in the literature .

These advanced methods could help resolve outstanding questions about CorA function, particularly regarding the precise conformational changes during gating and the nature of the ion permeation pathway through the channel.

What are the key unresolved questions in CorA research that merit further investigation?

Despite significant progress in understanding CorA, several fundamental questions remain unresolved:

  • Definitive Oligomeric State: The literature contains conflicting evidence suggesting CorA functions as either a homotetramer or a homopentamer . Resolving this discrepancy is crucial for accurate structural and functional models.

  • Complete Gating Mechanism: While recent studies have provided insights into conformational changes associated with gating , the precise sequence of events linking magnesium binding to channel opening/closing remains incompletely understood.

  • Ion Selectivity Determinants: The molecular basis for CorA's selectivity for magnesium over other divalent cations requires further characterization, particularly regarding the roles of specific amino acid residues in the transport pathway.

  • Physiological Regulation: Beyond magnesium concentration, additional factors that may regulate CorA activity in vivo (such as interactions with other proteins, lipids, or cellular conditions) remain largely unexplored.

  • Conformational Heterogeneity: Recent evidence suggests CorA exists in multiple conformational states , but the functional significance of this heterogeneity and how it relates to transport efficiency requires further investigation.

  • Evolutionary Relationships: While CorA is known to have homologs in archaea and eukaryotic mitochondria , the functional and structural conservation/divergence across these evolutionarily distant proteins merits deeper exploration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.