Recombinant Escherichia coli Maltose transport system permease protein malG (malG)

Shipped with Ice Packs
In Stock

Description

Overview of MalG and the Maltose Transport System

The E. coli maltose transport system is a binding protein-dependent ATP-binding cassette (ABC) transporter responsible for importing maltose and maltodextrins. MalG (maltose permease protein G) is a critical component of this system, functioning alongside MalF (membrane protein), MalK (ATPase subunit), and the periplasmic maltose-binding protein (MBP). MalG is an integral inner membrane protein essential for substrate recognition, assembly of the transport complex, and ATP-dependent translocation .

CharacteristicDetail
Protein Length296 amino acids (32.2 kDa)
HydrophobicityHydrophobic index = 0.83; six predicted transmembrane segments
Subcellular LocalizationInner membrane
FunctionForms MalFGK₂ complex; enables maltose/maltodextrin uptake via ATP hydrolysis

Functional Role in the Maltose Transport Complex

MalG’s primary roles include:

  1. Substrate Recognition: Binds the reducing end of maltodextrins in the periplasmic cavity .

  2. Complex Assembly: Forms a heterodimer with MalF, stabilized by conserved motifs near the C-terminus .

  3. Signal Transduction: Transmits conformational changes from MBP to MalK, triggering ATP hydrolysis .

Table 1: Functional Domains of MalG

DomainFunctionKey Residues/Features
N-Terminal RegionMembrane anchoringHydrophobic transmembrane segments
EAA---G---------I-LPSubstrate binding and transport efficiencyHydrophilic periplasmic loop
C-Terminal MotifInteraction with MalF and MalKConserved sequence (homologous to ABC transporters)

Mutant Studies

  • Insertion Mutagenesis:

    • Non-Essential Regions: Mutations in residues 30–50 (first transmembrane segment) or 153–157 (middle region) had minimal impact on transport .

    • Critical Regions: Insertions in periplasmic loops disrupted MBP interactions or MalK binding .

  • MBP-Independent Transport:

    • Mutations in malF or malG enabled maltose uptake without MBP, exposing a cryptic substrate-binding site .

    • Mechanism: Constitutive ATP hydrolysis by MalK drives cyclic conformational changes, bypassing the need for MBP .

Comparative Analysis with MalF and Other ABC Transporters

FeatureMalGMalFOther ABC Transporters
Sequence HomologyShares conserved C-terminal motif with MalF and ABC proteins Similar to MalG in membrane topologyHomologous motifs in all binding protein-dependent transporters
Role in TransportSubstrate recognition and MalK interactionATP hydrolysis-driven conformational changesVariable substrate specificity
Critical ResiduesEAA---G---------I-LP motif Walker A/B motifs (MalK) Walker motifs (ATPase)

Genetic and Biochemical Evidence

  • Gene Sequence: The malG gene encodes a 296-amino acid protein with a hydrophobic index of 0.83 .

  • Protein Localization: Detected in inner membrane fractions using anti-MalG antibodies .

  • Functional Reconstitution: Purified MalFGK₂ complexes reconstituted into proteoliposomes retained maltose transport activity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs.
Lead Time
Delivery time may vary based on purchasing method or location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can serve as a reference for customers.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
malG; b4032; JW3992; Maltose/maltodextrin transport system permease protein MalG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
malG
Target Protein Sequence
MAMVQPKSQKARLFITHLLLLLFIAAIMFPLLMVVAISLRQGNFATGSLIPEQISWDHWK LALGFSVEQADGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKAT LLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGY FETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDV NSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG
Uniprot No.

Target Background

Function
The MalEFGK transporter complex is involved in maltose/maltodextrin import. This protein is likely responsible for the translocation of the substrate across the membrane.
Gene References Into Functions
  1. Research indicates that the MalFGK2 transporter consists of two membrane proteins, MalF and MalG, and the nucleotide-binding domain, responsible for regulating the conformation of MalFG, is composed of the homodimeric MalK subunit. PMID: 27059961
  2. Findings suggest that the binding and conformational changes of the maltose transporter (MalFGK2) may provide insights into the mechanism of ABC transporters. PMID: 24865820
  3. Utilizing X-ray crystallography, a study captured the maltose transporter in an intermediate step between the inward- and outward-facing states PMID: 21566157
  4. An analysis of the MalFGK2 mechanism for coupling ATP hydrolysis to substrate translocation without direct substrate recognition. PMID: 20147285
  5. ATP-driven MalK dimer closure and reopening are crucial steps in the translocation cycle of the intact maltose transporter MalFGK2. PMID: 17545154
  6. Substrate availability is communicated from MalE to the MalK dimer through extracytoplasmic loops of MalFG. PMID: 17961142
  7. A 2.8-A crystal structure of the intact maltose transporter in complex with the maltose-binding protein, maltose, and ATP. PMID: 18033289

Show More

Hide All

Database Links
Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Structure and Function of MalG in E. coli

Q: What is MalG and what is its role in the maltose transport system?

MalG is a hydrophobic inner membrane component of the maltose transport system in Escherichia coli. It functions as one of the transmembrane subunits of the MalFGK₂ complex, which belongs to the ATP-binding cassette (ABC) superfamily of transporters . The complete maltose transport system consists of five proteins distributed across the bacterial envelope layers:

  • LamB: Outer membrane porin

  • MalE: Periplasmic maltose-binding protein (MBP)

  • MalF: Transmembrane domain protein

  • MalG: Transmembrane domain protein

  • MalK: Nucleotide-binding domain protein (two copies)

MalG works in concert with MalF to form a transmembrane channel that mediates the energy-dependent translocation of maltose and maltodextrins into the cytoplasm . The topological model derived from experimental analysis indicates that MalG spans the membrane six times and has both its amino- and carboxy-termini located in the cytoplasm .

Membrane Topology and Structural Characterization

Q: How has the membrane topology of MalG been experimentally determined?

The membrane topology of MalG has been elucidated using fusion protein methodology. Researchers have analyzed the topology by creating fusions between malG and 'phoA (a truncated gene encoding alkaline phosphatase lacking its translation initiation and exportation signals) . This approach leverages the principle that alkaline phosphatase is only active when translocated to the periplasmic space.

The experimental workflow involves:

  • Creating random or site-directed fusions between malG and 'phoA

  • Measuring alkaline phosphatase activity of the fusion proteins

  • Mapping regions that yield high activity (indicating periplasmic exposure) versus low activity (indicating cytoplasmic exposure)

  • Deducing the membrane-spanning segments based on this activity pattern

This methodology revealed that MalG has six transmembrane segments with both N-terminal and C-terminal ends residing in the cytoplasm . This knowledge is crucial for understanding how MalG interacts with other components of the transport complex and how it participates in substrate binding and translocation.

MalFGK Complex Assembly Mechanisms

Q: What are the critical factors that influence MalFGK complex assembly?

The assembly of the MalFGK complex involves several interdependent steps that can be assessed through both in vivo and in vitro approaches. Research has identified key factors affecting complex formation:

  • Chaperone-like function of MalK: MalK exhibits a chaperone-like function that facilitates the proper folding and assembly of MalF and MalG in the membrane . In the absence of MalK, MalF fails to fold into a protease-resistant form .

  • Subunit interdependence: When individual proteins (MalF, MalG, or MalK) are overexpressed without the complete complement of subunits, they tend to be insoluble in nonionic detergents .

  • Stable intermediates: A stable MalF-MalG complex can be solubilized from E. coli membranes and purified in high yield using MalK's chaperone-like function . This intermediate complex serves as a platform for subsequent assembly steps.

  • Critical structural contacts: Insertion mutations in MalK have been classified into two categories - assembly-proficient and assembly-defective . The regions containing insertions in assembly-proficient mutants correspond to surface-exposed areas within the complex, while assembly-deficient mutations affect critical structural contacts .

These findings demonstrate that the assembly of the MalFGK complex is a coordinated process where proper folding and interaction of individual components are prerequisites for functional complex formation.

Substrate Specificity Mechanisms

Q: How is substrate specificity determined in the maltose transport system at the molecular level?

The substrate specificity of the E. coli maltose transport system is determined through a sophisticated dual-recognition mechanism involving both the periplasmic maltose-binding protein (MBP) and the transmembrane components MalF and MalG . Crystal structures of the MBP-MalFGK₂ complex bound with malto-oligosaccharides in different conformational states have revealed the molecular basis for this specificity:

  • Periplasmic binding site: Formed by MBP and MalG, this site interacts specifically with four glucosyl units from the reducing end of the malto-oligosaccharide polymer .

  • Transmembrane binding site: Located within MalFGK₂, this site binds three glucosyl units from the opposite, non-reducing end of the sugar .

  • Polarized binding: The transport selectivity is explained through the polarity of substrate binding - MalG forms two hydrogen bonds with the malto-oligosaccharide at the reducing end in the pretranslocation state, while MalF binds three glucosyl units from the non-reducing end in the outward-facing conformation .

This structural arrangement ensures that only appropriate substrates (maltose and malto-oligosaccharides) are recognized and transported, while other sugars are excluded from the transport pathway.

Experimental Approaches for Recombinant MalG Expression

Q: What are optimal strategies for expressing recombinant MalG for structural and functional studies?

Expressing functional recombinant MalG presents several challenges due to its membrane protein nature and dependency on other maltose transport system components. Based on experimental evidence, the following strategies have proven effective:

  • Co-expression approach: Express MalG together with MalF and MalK to promote proper folding and complex formation . This leverages the chaperone-like function of MalK that drives MalF into a more protease-resistant conformation .

  • High-cell-density cultivation: Implement high-cell-density bacterial expression methods such as:

    • Autoinduction protocols

    • High-cell-density IPTG-induction methods

    These approaches can achieve cell densities (OD₆₀₀) of 10-20 using standard laboratory equipment without requiring fermenters .

  • Solubilization strategy: Use MalK as a chaperone to generate a detergent-soluble subassembly of MalF and MalG that can serve as a platform for complete complex assembly .

  • Extraction and purification protocol:

    • Solubilize membranes containing the MalFGK complex in nonionic detergents

    • Extract MalK using urea while maintaining MalF-MalG association

    • Purify the MalF-MalG complex by affinity chromatography

    • Reassemble the full complex by adding purified MalK

This approach allows for differential manipulation of the transmembrane and nucleotide-binding subunits, enabling advanced biophysical studies such as fluorescence energy transfer measurements between components .

Functional Assessment of Recombinant MalG

Q: How can researchers assess whether recombinant MalG is functionally active?

Evaluating the functional integrity of recombinant MalG requires assessing its ability to form a proper complex with other components and participate in transport activity. Several complementary methods have been established:

  • Complex assembly verification:

    • Analytical gel filtration to confirm proper oligomeric state

    • Co-purification assays to demonstrate association with MalF and MalK

    • Resistance to proteolysis as an indicator of proper folding

  • Transport activity assays:

    • Reconstitution of purified MalFGK₂ complex into proteoliposomes

    • Measurement of maltose transport into proteoliposomes

    • Quantification of MBP-stimulated ATPase activity

A functionally reconstituted system should display both MBP-stimulated ATPase activity and maltose transport activity at rates comparable to in vivo-assembled transporters. As a control, proteoliposomes containing only the MalF-MalG complex (without MalK) should show no significant activity above background levels .

Mutational Analysis Approaches for MalG

Q: What strategies can be employed for conducting meaningful mutational analysis of MalG?

Mutational analysis provides critical insights into structure-function relationships of MalG. Based on successful approaches with related transport components, the following strategies are recommended:

  • Insertion mutagenesis: Create a set of similar insertions (e.g., 31 codons) distributed throughout malG to analyze protein structure and folding . Classify mutations based on:

    • Complex assembly proficiency

    • Transport activity

    • Regulatory function

  • Targeted mutagenesis of predicted binding regions: Based on structural information, mutate residues in MalG that are predicted to interact with:

    • Substrate molecules (particularly at the reducing end of malto-oligosaccharides)

    • Other components of the transport complex

    • The membrane environment

  • Functional classification scheme: Categorize mutations into distinct phenotypic classes:

    • Assembly-proficient: Corresponding to surface-exposed regions within the MalFGK complex

    • Assembly-deficient: Affecting critical structural contacts necessary for proper complex formation

    • Transport-deficient but assembly-competent: Identifying residues specifically involved in substrate translocation

This approach helps differentiate between mutations affecting protein structure/folding versus those specifically disrupting transport function or component interactions.

Advanced Research Question: Data Contradiction Analysis

Q: How should researchers approach contradictory findings in MalG structural or functional studies?

When analyzing contradictory data regarding MalG and the maltose transport system, researchers should implement a systematic contradiction pattern analysis framework:

  • Classify contradiction types using a (α,β,θ) notation:

    • α: Number of interdependent items or experimental variables

    • β: Number of contradictory dependencies identified

    • θ: Minimal number of Boolean rules required to assess contradictions

  • Implement a structured validation protocol:

    • Verify experimental conditions, particularly detergent types and concentrations used for membrane protein solubilization

    • Consider strain-specific differences in expression systems

    • Examine differences in complex assembly conditions

    • Evaluate potential differences in functional assay sensitivities

  • Reconciliation strategies:

    • Perform side-by-side comparisons under standardized conditions

    • Consider structural dynamics and multiple conformational states

    • Implement complementary biophysical techniques to resolve ambiguities

    • Develop mathematical models that can accommodate apparently contradictory observations

This structured approach helps manage the complexity of multidimensional interdependencies within experimental data sets and supports implementation of a generalized contradiction assessment framework .

Experimental Design for MalG Transport Mechanism Studies

Q: What experimental design approaches are most effective for investigating the transport mechanism of MalG?

Investigating the mechanistic details of MalG's role in transport requires carefully designed experiments that can capture dynamic conformational changes and energy coupling. Effective experimental design should incorporate:

  • Factorial design methodology:

    • Identify key independent variables (substrate concentration, ATP levels, MBP concentration)

    • Define appropriate dependent variables (transport rate, ATPase activity)

    • Control extraneous variables to prevent external factors from affecting results

    • Determine optimal statistical conditions for experimental delivery

  • Time-resolved structural studies:

    • Capture intermediate states in the transport cycle using rapid kinetic methods

    • Employ time-resolved crystallography or cryo-EM to visualize conformational changes

    • Use fluorescence resonance energy transfer (FRET) between labeled components to monitor real-time structural dynamics

  • Reconstitution systems:

    • In vitro reconstitution of purified components into proteoliposomes

    • Development of nanodiscs containing the MalFGK₂ complex for single-molecule studies

    • Implementation of supported lipid bilayers for electrical measurements

  • Complementary biophysical techniques:

    • EPR spectroscopy to monitor conformational changes

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Single-molecule FRET to observe conformational states of individual complexes

The experimental design should establish validity, reliability, and replicability while achieving appropriate levels of statistical power and sensitivity .

Systems Biology Approaches for Studying MalG Function

Q: How can systems biology approaches enhance our understanding of MalG function within the cellular context?

Systems biology offers powerful frameworks for integrating MalG function within the broader cellular context and metabolic networks:

This systems-level perspective provides insights into how MalG function is integrated with cellular metabolism and regulation, offering a comprehensive understanding beyond isolated biochemical studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.