Recombinant Escherichia coli Mannose permease IIC component (manY)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Phosphotransferase System

The manY protein is essential for mannose import via the PTS, a process coupling transport with phosphorylation. Key mechanistic insights:

  • Sugar Transport: Mediates mannose translocation across the cytoplasmic membrane, followed by phosphorylation using phosphoenolpyruvate as the energy source .

  • Domain Interactions: Collaborates with the soluble IIIMan subunit, which transfers phosphate groups from HPr (histidine-containing phosphocarrier protein) to the transported sugar .

  • Genetic Regulation: Part of the man operon, co-regulated with other PTS components to optimize carbohydrate utilization under varying metabolic conditions .

Recombinant Production and Challenges

Producing functional manY recombinantly requires addressing inherent complexities of membrane protein expression:

  • Expression Systems: Optimized in E. coli using tunable promoters (e.g., Lemo system) to balance protein yield and cell viability .

  • Toxicity Mitigation: Co-expression of chaperones (e.g., DnaK, GroEL) and controlled induction mitigate translocon saturation and cytoplasmic aggregation .

  • Purification: Affinity tags (e.g., His-tag) and detergent solubilization preserve structural integrity during extraction .

Table 2: Key Production Parameters

ParameterDetail
Host StrainE. coli BL21(DE3) or similar
Induction MethodIPTG or L-rhamnose (e.g., Lemo system)
Yield>90% purity via affinity chromatography
Endotoxin Levels<1.0 EU/μg upon request

Research Applications

This recombinant protein is pivotal in diverse studies:

  • Mechanistic Studies: Elucidating PTS-driven transport kinetics and phosphorylation dynamics .

  • Metabolic Engineering: Enhancing sugar uptake in industrial E. coli strains for biofuel or biopolymer production .

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve transmembrane domain architecture .

  • Antimicrobial Research: Investigating mannose analogs as inhibitors targeting pathogen PTS systems .

Unresolved Questions and Future Directions

  • Role in Virulence: While Listeria EIIMan influences virulence gene regulation, analogous roles in E. coli remain underexplored .

  • Hinge Flexibility: The proteolytically sensitive hinge region in IIIMan warrants further study to engineer stabilized variants .

  • Industrial Scaling: Improving membrane protein yields in bioreactors while maintaining functionality .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
manY; pel; ptsP; b1818; JW1807; PTS system mannose-specific EIIC component; EII-P-Man; EIIC-Man; Mannose permease IIC component
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
manY
Target Protein Sequence
MEITTLQIVLVFIVACIAGMGSILDEFQFHRPLIACTLVGIVLGDMKTGIIIGGTLEMIA LGWMNIGAAVAPDAALASIISTILVIAGHQSIGAGIALAIPLAAAGQVLTIIVRTITVAF QHAADKAADNGNLTAISWIHVSSLFLQAMRVAIPAVIVALSVGTSEVQNMLNAIPEVVTN GLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNFNLVALGVIGTVMAVLYIQ LSPKYNRVAGAPAQAAGNNDLDNELD
Uniprot No.

Target Background

Function
The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concurrently with their translocation across the cell membrane. The enzyme II ManXYZ PTS system is involved in mannose transport. It also functions as a receptor for bacterial chemotaxis and is essential for infection of cells by bacteriophage lambda. The likely mechanism of action in the latter case involves the formation of a pore for the penetration of lambda DNA.
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Mannose permease IIC component (manY) in Escherichia coli?

The mannose permease IIC component (manY) is an integral membrane protein that functions as part of the mannose-specific phosphotransferase system (PTS) in E. coli. It is one of the transmembrane subunits of the complete mannose permease complex, which consists of two transmembrane domains (II-PMan and II-MMan) and a hydrophilic domain (IIIMan) . The IIC component specifically forms part of the channel through which mannose and related hexoses are transported across the cell membrane. This transport process is coupled with phosphorylation, allowing the bacterium to simultaneously import and modify sugars for metabolism .

The manY protein works in concert with other components of the mannose PTS to facilitate sugar uptake. This system is particularly important for E. coli as it represents a major pathway for glucose transport and utilization, contributing to the bacterium's ability to thrive in various environments and carbon sources.

How does the Mannose PTS system structure relate to its function?

The mannose PTS functions through a coordinated multi-component system with distinct structural domains that enable coupled transport and phosphorylation. The complete system includes:

  • Transmembrane domains (II-PMan and II-MMan): Form the channel for sugar translocation across the membrane

  • Hydrophilic subunit (IIIMan): Contains two functionally distinct domains (P13 and P20) connected by a flexible hinge with the sequence KAAPAPAAAAPKAAPTPAKP

The functional mechanism involves sequential phosphorylation events:

  • The NH₂-terminal domain (P13) is phosphorylated at N-3 of His-10 by the cytoplasmic phosphorylcarrier protein phospho-HPr

  • The COOH-terminal domain (P20) is subsequently phosphorylated by P13 at N-1 of His-175

  • In the presence of IIMan subunits, the phosphoryl group is transferred from His-175 of P20 directly to the sugar substrates

This architecture enables efficient coupling of transport with modification, demonstrating how structural organization directly supports the functional activity of the system.

What is the genetic organization of manY and related components?

The mannose permease components in E. coli are encoded within the mannose permease (mpt) operon, which contains genes for multiple subunits of the PTS system. The manY gene specifically encodes the IIC component, which forms the transmembrane channel portion of the permease.

In comparative systems like Listeria monocytogenes, similar mannose PTS operons have been identified, including genes encoding IIA, IIB, IIC, and IID subunits . For example:

  • lmo1997 (encodes a IIAᴹᵃⁿ subunit)

  • lmo2000 (encodes a IIDᴹᵃⁿ subunit)

  • lmo2001 (encodes a IICᴹᵃⁿ subunit)

  • lmo2002 (encodes a IIBᴹᵃⁿ subunit)

While these genes may not be contiguous, they can function as a transcriptional unit, demonstrating how related components are genetically organized to ensure coordinated expression .

What are the optimal experimental designs for studying manY function?

When investigating manY function, researchers should implement controlled experimental designs that allow clear determination of cause-effect relationships. The following framework provides a methodological approach:

  • Define variables clearly:

    • Independent variables: Expression levels of manY, presence of specific sugars, mutations in key residues

    • Dependent variables: Transport rates, phosphorylation efficiency, growth rates

    • Control variables: Temperature, media composition, expression system

  • Design systematic manipulations:

    • Create recombinant constructs with varying expression levels of manY

    • Introduce site-directed mutations at functional residues

    • Test transport capacity under different substrate concentrations

  • Isolation of experimental effects:

    • Use knockout strains lacking endogenous mannose permease components

    • Complement with plasmid-based expression of wild-type or mutant manY

    • Include proper controls (empty vector, inactive mutants)

This approach allows researchers to attribute observed effects specifically to manY function while controlling for confounding variables that might influence results .

How should researchers approach membrane protein purification for manY studies?

Purification of membrane proteins like manY requires specialized protocols that maintain protein integrity while extracting from the lipid bilayer:

Protocol outline:

  • Strain selection and growth:

    • Use E. coli strains optimized for membrane protein expression (C41, C43)

    • Culture in minimal media supplemented with appropriate carbon sources

    • Induce expression at lower temperatures (18-25°C) to prevent inclusion bodies

  • Membrane isolation:

    • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

    • Resuspend in buffer containing protease inhibitors

    • Disrupt cells using French press or sonication

    • Remove cell debris (12,000 × g, 20 min, 4°C)

    • Ultracentrifuge to collect membranes (100,000 × g, 1 h, 4°C)

  • Solubilization and purification:

    • Solubilize membrane pellet with gentle detergents (DDM, LMNG)

    • Clarify by ultracentrifugation (100,000 × g, 30 min, 4°C)

    • Purify using affinity chromatography (if tagged) or ion exchange

    • Perform size exclusion chromatography for final purification

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm identity

    • Circular dichroism to verify secondary structure integrity

    • Dynamic light scattering to assess homogeneity

This methodical approach maximizes the yield of correctly folded manY for functional and structural studies.

How can researchers resolve contradictory data in manY functional studies?

When faced with contradictory data in manY research, a systematic approach to data integration is essential:

  • Evaluate methodological differences:

    • Analyze variations in experimental conditions

    • Assess differences in strain backgrounds and genetic contexts

    • Consider differences in expression systems and protein tags

  • Apply mixed methods analysis:

    • Integrate quantitative transport measurements with qualitative structural assessments

    • Consider that contradictions may arise from different levels of analysis (molecular vs. cellular)

    • Examine if contradictions represent different facets of the same phenomenon

  • Implement reconciliation strategies:

    • Perform additional experiments with standardized conditions

    • Use multiple techniques to validate a single finding

    • Consider theoretical models that could explain apparent contradictions

  • Reporting framework for contradictory results:

Data TypeFinding AFinding BPotential ExplanationResolution Approach
Transport kineticsHigh affinityLow affinityDifferent lipid environmentsReconstitution in defined liposomes
PhosphorylationRequired for functionFunction without phosphorylationDifferent phosphorylation sitesSite-directed mutagenesis
Topology6 transmembrane domains8 transmembrane domainsDifferent prediction algorithmsExperimental topology mapping

As noted in source , contradictions in data should not be viewed as failures but as opportunities to develop more nuanced understanding of complex biological systems .

What statistical approaches are most appropriate for analyzing manY expression and activity data?

Analyzing manY expression and activity requires appropriate statistical methods that account for the complexity of membrane protein data:

  • For expression level analysis:

    • Use ANOVA with post-hoc tests to compare expression across multiple conditions

    • Apply non-parametric tests (e.g., Mann-Whitney U) when assumptions of normality are violated

    • Utilize regression models to identify factors influencing expression levels

  • For transport activity measurements:

    • Employ Michaelis-Menten kinetics analysis to determine Km and Vmax values

    • Use paired t-tests to compare wild-type and mutant activities

    • Apply repeated measures designs to track activity over time

  • For structure-function relationships:

    • Use multiple regression to correlate structural features with functional outcomes

    • Apply principal component analysis to identify patterns in mutagenesis data

    • Implement factorial designs to assess interaction effects between mutations

  • Data presentation guidelines:

    • Present raw data alongside fitted curves for transport assays

    • Include appropriate error bars (standard deviation or standard error)

    • Report exact p-values rather than significance thresholds

These approaches ensure robust analysis of manY data while maintaining scientific rigor and transparency in reporting .

How does phosphorylation cascade regulation affect manY function?

The phosphorylation cascade regulating manY function represents a sophisticated control mechanism that integrates cellular metabolic state with transport activity:

Phosphorylation pathway mechanism:

  • Initial phosphorylation of the general PTS component Enzyme I by phosphoenolpyruvate (PEP)

  • Transfer to the histidine-containing protein HPr

  • Phospho-HPr transfers phosphate to the NH₂-terminal domain (P13) of IIIᴹᵃⁿ at His-10

  • P13 transfers phosphate to the COOH-terminal domain (P20) at His-175

  • P20 transfers phosphate directly to transported sugars in the presence of IIᴹᵃⁿ subunits

This cascade allows for regulation at multiple levels and can occur both within a single IIIᴹᵃⁿ subunit and between domains on different subunits of the dimer .

Experimental approaches to study phosphorylation effects:

  • Generate phosphorylation site mutants (H10A, H175A)

  • Employ radioactive ³²P-labeling to track phosphate transfer

  • Use phosphomimetic amino acid substitutions

  • Measure transport kinetics under varying phosphorylation conditions

Understanding this cascade is crucial as it not only controls transport activity but may also influence gene expression through carbon catabolite repression mechanisms.

What are the cutting-edge approaches for structure-function analysis of manY?

Contemporary structure-function analysis of manY employs multidisciplinary approaches combining molecular, biophysical, and computational techniques:

  • Advanced mutagenesis strategies:

    • CRISPR-Cas9 genome editing for chromosomal modifications

    • Deep mutational scanning to assess thousands of variants simultaneously

    • Unnatural amino acid incorporation to probe specific chemical interactions

  • Structural biology methods:

    • Cryo-electron microscopy to determine membrane protein structures in near-native states

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Solid-state NMR to study membrane-embedded conformations

  • Computational approaches:

    • Molecular dynamics simulations of manY in lipid bilayers

    • Machine learning models to predict impact of mutations

    • Quantum mechanics calculations of proton transfer mechanisms

  • Functional assessment techniques:

    • Single-molecule FRET to observe conformational changes during transport

    • Electrophysiology to measure sugar-induced currents

    • Microfluidics-based high-throughput transport assays

These approaches collectively provide unprecedented insights into the structure-function relationships of manY and its role within the mannose permease complex.

How does the mannose permease system interact with carbon catabolite repression pathways?

The mannose permease system plays a complex role in carbon catabolite repression (CCR), with manY functioning as both a transporter and a regulatory component:

Regulatory interactions:

  • In glucose-rich environments, the mannose PTS (including manY) contributes to CCR of alternative sugar utilization pathways

  • The IIC component participates in signaling cascades that influence the phosphorylation state of regulatory proteins

  • The EIIᵗᴹᵃⁿ permease (which includes the manY component) contributes to CCR of PTS operons to varying degrees

Experimental evidence from related systems:

  • In Listeria monocytogenes, CCR of the lmo0027 gene was strongly dependent on EIIᵗᴹᵃⁿ expression

  • In contrast, CCR of other mannose PTS permease genes (lmo0024, lmo1997, lmo2002) was not dependent on EIIᵗᴹᵃⁿ

  • Transcriptional regulation of ManR (a regulator) occurs via an EIIᵗᴹᵃⁿ-dependent mechanism in media lacking glucose

These findings suggest that manY and the mannose permease complex participate in sophisticated regulatory networks that connect carbon source availability to gene expression patterns.

What are the best approaches for optimizing recombinant manY expression?

Optimizing recombinant manY expression requires addressing the challenges inherent to membrane protein production:

Expression optimization protocol:

  • Vector and strain selection:

    • Use vectors with tunable promoters (pBAD, pET with lac operators)

    • Select specialized strains (C41/C43, Lemo21) designed for membrane protein expression

    • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Expression conditions optimization:

    ParameterTest RangeOptimization Goal
    Temperature16-37°CLower temperatures often reduce aggregation
    Inducer concentration0.01-1.0 mM IPTGMinimal induction often yields better folding
    Media compositionLB, TB, M9, autoinductionComplex media may enhance expression
    Growth phase at inductionOD₆₀₀ 0.4-1.2Earlier induction often favors membrane integration
    Duration3-24 hoursBalance between yield and quality
  • Membrane preparation optimization:

    • Gentle cell lysis (enzymatic methods or French press)

    • Careful membrane fraction isolation

    • Detergent screening for optimal solubilization

  • Quality assessment:

    • FSEC (fluorescence-detection size exclusion chromatography) to assess homogeneity

    • Functional assays to confirm proper folding and activity

    • Mass spectrometry to verify integrity and modifications

This systematic approach allows researchers to identify optimal conditions for producing functional recombinant manY protein suitable for biochemical and structural studies.

How can researchers effectively analyze manY membrane topology?

Determining the membrane topology of manY requires complementary experimental approaches:

  • Computational prediction:

    • Use multiple topology prediction algorithms (TMHMM, Phobius, TOPCONS)

    • Generate consensus predictions across different methods

    • Identify potential transmembrane segments and their orientation

  • Experimental topology mapping:

    • PhoA/LacZ fusion analysis: Create systematic fusions throughout manY sequence and assess activity (PhoA active in periplasm, LacZ in cytoplasm)

    • Cysteine accessibility method: Introduce cysteine residues and test accessibility to membrane-impermeable reagents

    • Epitope insertion: Insert epitope tags at various positions and determine accessibility by immunofluorescence

  • Structural approaches:

    • Limited proteolysis to identify exposed regions

    • Site-directed spin labeling combined with EPR spectroscopy

    • High-resolution structural methods (X-ray crystallography, cryo-EM)

  • Data integration:

    • Develop a topological model integrating all experimental data

    • Validate model against evolutionary conservation patterns

    • Refine model based on functional constraints

This multi-faceted approach provides robust determination of manY's membrane topology, which is essential for understanding its transport mechanism and interactions with other components of the mannose permease system.

What are the emerging research questions in manY and mannose permease studies?

The field of manY research continues to evolve, with several promising directions for future investigation:

  • Structural biology frontiers:

    • Determining high-resolution structures of the complete mannose permease complex

    • Capturing different conformational states during the transport cycle

    • Elucidating the structural basis for sugar specificity and recognition

  • Regulatory network integration:

    • Mapping the full extent of manY's involvement in carbon catabolite repression

    • Understanding how transport activity couples with transcriptional regulation

    • Identifying novel regulatory partners that modulate mannose permease function

  • Systems biology perspectives:

    • Integrating manY function into genome-scale metabolic models

    • Understanding how mannose transport coordinates with broader cellular metabolism

    • Investigating evolutionary adaptations of the mannose PTS across bacterial species

  • Biotechnological applications:

    • Engineering manY variants with altered substrate specificity

    • Developing biosensors based on mannose permease components

    • Exploiting manY's regulatory functions for metabolic engineering applications

These research directions promise to deepen our understanding of this important transport system while potentially opening new avenues for biotechnological innovation.

How can contradictory findings about manY be reconciled within a unified model?

Contradictory findings about manY can be reconciled through a systematic framework that embraces the complexity of membrane transport systems:

  • Context-dependent function model:

    • Recognize that manY may function differently depending on cellular conditions

    • Consider how membrane composition affects protein behavior

    • Account for interactions with different partner proteins

  • Multifunctional protein paradigm:

    • Acknowledge that manY may have distinct transport and regulatory functions

    • Map specific domains to different functional roles

    • Understand how these functions may be differentially regulated

  • Integration of experimental approaches:

    • Combine in vivo and in vitro findings to develop more complete models

    • Use mixed methods research to address different aspects of function

    • Develop mathematical models that can account for seemingly contradictory observations

  • Systematic reporting framework:

    • Clearly document experimental conditions that lead to different outcomes

    • Present contradictory findings as opportunities for deeper understanding

    • Develop standardized assays to allow direct comparison between studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.