Recombinant Escherichia coli Methyl-accepting chemotaxis protein III (trg)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
trg; b1421; JW1417; Methyl-accepting chemotaxis protein III; MCP-III; Ribose and galactose chemoreceptor protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
trg
Target Protein Sequence
MNTTPSQRLGFLHHIRLVPLFACILGGILVLFALSSALAGYFLWQADRDQRDVTAEIEIR TGLANSSDFLRSARINMIQAGAASRIAEMEAMKRNIAQAESEIKQSQQGYRAYQNRPVKT PADEALDTELNQRFQAYITGMQPMLKYAKNGMFEAIINHESEQIRPLDNAYTDILNKAVK IRSTRANQLAELAHQRTRLGGMFMIGAFVLALVMTLITFMVLRRIVIRPLQHAAQRIEKI ASGDLTMNDEPAGRNEIGRLSRHLQQMQHSLGMTVGTVRQGAEEIYRGTSEISAGNADLS SRTEEQAAAIEQTAASMEQLTATVKQNADNAHHASKLAQEASIKASDGGQTVSGVVKTMG AISTSSKKISEITAVINSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRTLASRSAQ AAKEIEGLISESVRLIDLGSDEVATAGKTMSTIVDAVASVTHIMQEIAAASDEQSRGITQ VSQAISEMDKVTQQNASLVEEASAAAVSLEEQAARLTEAVDVFRLHKHSVSAEPRGAGEP VSFATV
Uniprot No.

Target Background

Function
This protein mediates chemotaxis towards ribose and galactose through interaction with periplasmic ribose- or galactose-binding proteins. Chemotactic signal transducers respond to changes in attractant and repellent concentrations, transducing extracellular signals intracellularly and facilitating sensory adaptation via methylation level variations. Attractants increase methylation (via CheR methyltransferase), while repellents decrease it (via CheB methylesterase).
Gene References Into Functions
  1. In vitro studies demonstrate involvement in adaptational modifications (methylation, demethylation, and deamidation) assisted by Tar. PMID: 15916610
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Note=Found predominantly at cell poles.

Q&A

What is the basic structure and function of Methyl-accepting Chemotaxis Protein III (trg) in E. coli?

Methyl-accepting chemotaxis protein III (MCP III), encoded by the trg gene in Escherichia coli, is an integral membrane protein that functions as a chemoreceptor. Like other known methyl-accepting chemotaxis proteins, the trg product is a membrane protein that migrates as multiple species in sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), indicating it undergoes multiple methylation events . This protein serves as a transducer linking chemoreceptors to the tumble regulator, forming part of a sophisticated sensory system that allows bacteria to navigate toward favorable environments and away from harmful substances . The trg protein belongs to a group of transmembrane MCPs responsible for sensing external stimuli that help bacteria orient themselves in chemical gradients .

What post-translational modifications occur in the trg protein, and what is their significance?

The trg protein, like other methyl-accepting chemotaxis proteins in E. coli, undergoes two primary types of post-translational modifications crucial for its function. The first is reversible methylation, which occurs in response to attractants and plays a key role in adaptation . The second modification, termed CheB-modification, is repellent-stimulated and depends on the CheB gene product . This modification causes a decrease in mobility of MCPs on 7.5% SDS-polyacrylamide gels with a high acrylamide to bisacrylamide ratio and reduces the isoelectric point of MCPs by one or two charge groups . Importantly, CheB-modification is not necessary for methylation and does not preclude methylation of the MCPs . Both modifications contribute to the fine-tuning of chemotactic responses, allowing bacteria to adapt to persistent stimuli while remaining sensitive to new changes in the chemical environment.

How does the trg gene compare with other MCP-encoding genes in E. coli?

In E. coli, there are multiple genes encoding methyl-accepting chemotaxis proteins, including tsr, tar, and trg. The products of these genes serve as membrane protein transducers that link chemoreceptors to the tumble regulator . While all these proteins share the common feature of being methyl-accepting and undergoing multiple methylation events, they differ in their specificity for certain attractants and repellents . Research comparing the gene products has shown that they all participate in the same chemotaxis signaling pathway but respond to different chemical stimuli . The steady-state level of methylation for these proteins can be affected by mutations in other components of the pathway, as demonstrated by the observation that Tar protein methylation levels increase in cheD strains with aberrant Tsr function . This interdependence suggests a complex regulatory network governing bacterial chemotaxis.

What is the role of trg protein in the formation of chemoreceptor arrays at the cell pole?

The trg protein, similar to other MCPs in E. coli, participates in the formation of highly ordered supramolecular arrays at the subcellular poles . These arrays are composed of core units consisting of two chemoreceptors, one CheA dimer, and two adaptor proteins CheW . The organization into these arrays serves a critical function in chemotaxis: it amplifies small signals and improves positive cooperativity in the chemotactic response . The polar localization of these arrays is not random but rather represents a strategic positioning that maximizes sensitivity to environmental gradients. Understanding how trg contributes to these complex structures is essential for comprehending the spatial organization of the chemotaxis machinery and its impact on bacterial behavior.

What methodologies can be employed to study the interaction between trg and the CheA-CheW complex in recombinant systems?

Studying the interaction between recombinant trg and the CheA-CheW complex requires sophisticated biochemical and biophysical approaches. Researchers can employ co-immunoprecipitation assays using antibodies specific to tagged versions of trg, CheA, or CheW to pull down protein complexes and analyze their composition. Fluorescence resonance energy transfer (FRET) offers another valuable approach, where trg and its interaction partners are labeled with appropriate fluorophores to detect proximity-dependent energy transfer. For structural studies, cryo-electron microscopy has proven effective in visualizing the hexagonal arrays formed by chemoreceptors with CheA and CheW, providing insights into how trg integrates into these structures.

When implementing these methods, researchers should consider expressing the recombinant proteins under the control of the native trg promoter to maintain physiological expression levels . Furthermore, fusion constructs similar to the McpT-mCherry or PcaY-mCherry approaches described for other chemoreceptors can be developed to visualize trg localization within bacterial cells . These fusion proteins should be carefully designed to preserve the functionality of the chemoreceptor while allowing for detection and tracking within living cells.

How can heterologous expression systems be optimized for functional studies of recombinant trg protein?

For functional studies, it is essential to verify proper membrane localization of the expressed trg protein. This can be achieved through fractionation studies or fluorescent fusion proteins that allow visualization of membrane targeting and polar clustering . Additionally, complementation assays in trg-null mutant strains can confirm the functionality of the recombinant protein. Researchers should be mindful that chemoreceptor clustering and function depend on proper interaction with CheA and CheW proteins, so expression levels of these components may need adjustment to achieve optimal function of the recombinant system .

What are the potential applications of engineered trg protein variants in synthetic biology approaches for biosensing?

Engineered variants of the trg protein offer significant potential for developing novel biosensors based on bacterial chemotaxis. The trg promoter has already been utilized to express heterologous chemoreceptors in E. coli, demonstrating the feasibility of this approach . By modifying the sensory domain of trg while preserving its signaling capabilities, researchers can create bacteria that exhibit directed movement toward specific compounds of interest, including environmental pollutants or disease biomarkers.

For example, following the approach used for the PmrA/PmrB system that was engineered to detect lanthanide ions, the ligand-binding domain of trg could be replaced with peptides or domains that specifically recognize target molecules . These modified chemoreceptors could then control the expression of CheZ or other chemotaxis proteins, enabling engineered bacteria to move toward or accumulate near the target compounds . This strategy has particular relevance for environmental monitoring and bioremediation applications, where bacteria could be designed to detect and respond to specific pollutants or toxic compounds in complex environments .

How does the modification state of trg protein affect its signaling properties and integration into chemoreceptor arrays?

The modification state of the trg protein significantly influences its signaling properties through multiple mechanisms. The methylation level of trg affects its conformational state and thus its ability to activate CheA, with higher methylation generally corresponding to increased CheA activation . Additionally, the CheB-modification, which is distinct from methylation, alters the charge distribution on the protein and affects its interactions with other components of the chemotaxis machinery .

These modifications impact not only the individual protein's function but also its integration into chemoreceptor arrays. Research suggests that the methylation state can influence receptor packing within the hexagonal arrays and thereby affect signal amplification and cooperativity . Experimental approaches to study these effects include quantitative immunoblotting to measure methylation levels, mass spectrometry to identify specific modified residues, and high-resolution microscopy techniques to visualize array formation under different modification conditions. Recent advances in cryo-electron tomography have allowed researchers to observe these arrays in near-native conditions, revealing how modification states influence the three-dimensional organization of chemoreceptor clusters.

What protocols are most effective for isolating functional recombinant trg protein while maintaining its native conformation?

Isolating functional recombinant trg protein presents challenges due to its integral membrane nature. The most effective protocols employ a combination of gentle detergent solubilization and affinity chromatography. Initial isolation typically begins with bacterial cell lysis using methods that preserve protein structure, such as French press or sonication in buffer systems containing protease inhibitors. For membrane extraction, detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration effectively solubilize the membrane while maintaining protein structure.

Affinity tags such as poly-histidine or Strep-tag II placed at the C-terminus of trg minimize interference with the transmembrane and sensing domains. Following affinity purification, size-exclusion chromatography helps separate functional trg protein from aggregates and misfolded variants. Throughout the purification process, it's crucial to maintain the methylation state by including appropriate buffer components that inhibit methylesterase activity. The functional integrity of the isolated protein can be verified through in vitro reconstitution assays with purified CheA and CheW to assess kinase regulation capability . This systematic approach yields high-purity trg protein suitable for structural and functional studies.

How can researchers effectively design experiments to study the methylation patterns of recombinant trg protein?

Designing experiments to study methylation patterns of recombinant trg protein requires specialized approaches to detect and quantify these modifications. Radiolabeling with methyl-³H-labeled S-adenosylmethionine (SAM) provides a sensitive method to track methylation events in vivo . Researchers can express recombinant trg in the presence of this labeled methyl donor, then analyze the incorporation patterns through SDS-PAGE separation followed by fluorography or scintillation counting of excised gel bands.

For more detailed analysis, mass spectrometry offers the ability to precisely identify methylation sites. Sample preparation typically involves digestion with proteases like trypsin or chymotrypsin, followed by liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS). Site-directed mutagenesis of putative methylation sites, converting glutamate residues to glutamine (which cannot be methylated but maintains similar physicochemical properties), allows researchers to study the functional significance of specific methylation events.

Researchers should also consider using two-dimensional gel electrophoresis to separate different methylation states, as this technique can resolve proteins with slight charge differences resulting from varying degrees of methylation . When comparing wild-type and mutant forms of trg, maintaining identical growth conditions and sample processing is essential to ensure that observed differences reflect genuine biological variation rather than experimental artifacts .

What approaches can be used to visualize the subcellular localization of trg protein in recombinant E. coli systems?

Visualizing subcellular localization of trg protein in recombinant E. coli systems can be achieved through several complementary imaging approaches. Fluorescent protein fusions, where trg is genetically fused to fluorescent proteins like mCherry or GFP, represent the most widely used method . These constructs allow for real-time visualization of trg localization in living cells, revealing its distribution at cell poles and membrane regions. The fusion should be designed to minimize interference with trg function, typically by placing the fluorescent tag at the C-terminus with a flexible linker.

Immunofluorescence microscopy provides an alternative approach that doesn't require genetic modification of the protein itself. This technique involves fixing cells, permeabilizing membranes, and using antibodies specific to trg or to an attached epitope tag. Super-resolution microscopy techniques such as PALM (Photoactivated Localization Microscopy) or STORM (Stochastic Optical Reconstruction Microscopy) can resolve individual clusters of chemoreceptors, providing insights into array formation and organization.

For correlative studies, researchers can combine fluorescence microscopy with electron microscopy. By expressing trg-mCherry fusions and processing samples for electron microscopy, the fluorescence signal can guide the identification of relevant structures for higher-resolution analysis . Cryo-electron tomography offers particularly valuable insights, as it can resolve the hexagonal arrays formed by chemoreceptors and their associated proteins in near-native conditions, revealing how trg integrates into these complex signaling structures .

What quantitative methods can accurately assess the functional activity of recombinant trg protein in chemotaxis assays?

Assessing the functional activity of recombinant trg protein requires quantitative methods that can accurately measure chemotactic responses. The capillary assay, a classic technique, involves placing a capillary tube containing an attractant solution into a bacterial suspension and quantifying the number of bacteria that accumulate in the capillary over time. This method can be adapted for high-throughput screening by using multi-well plates and automated cell counting.

Microfluidic devices offer more sophisticated analysis by generating stable chemical gradients and allowing real-time tracking of bacterial movement. These systems can precisely control gradient steepness and stability while enabling microscopic observation of single-cell behaviors, providing detailed information about run lengths, tumble frequency, and directional persistence. The FRET-based approach using CheY-YFP and CheZ-CFP fusion proteins provides a biochemical readout of chemotaxis pathway activity, measuring the real-time kinase activity stimulated by trg in response to attractants or repellents.

For population-level assessment, the swim plate assay measures the expansion rate of bacterial colonies on semi-solid agar containing attractants or repellents. This simple yet effective method can compare the chemotactic efficiency of different trg variants or expression systems . When conducting these assays, researchers should include appropriate controls such as wild-type E. coli strains and trg-deletion mutants to establish reference points for normal and defective chemotaxis . The data should be analyzed using quantitative metrics such as the chemotactic ratio (the ratio of bacteria accumulating in test versus control capillaries) or drift velocity in gradient environments.

What are common challenges in expressing functional recombinant trg protein and how can they be addressed?

Researchers frequently encounter several challenges when expressing functional recombinant trg protein. One common issue is low expression yield, which can result from codon usage bias, particularly when expressing the protein in heterologous hosts. This can be addressed by optimizing codons for the expression host or using specialized strains with additional copies of rare tRNAs. Toxicity due to membrane protein overexpression represents another challenge, often manifesting as growth inhibition or formation of inclusion bodies. Implementing tightly regulated inducible promoters and lowering induction temperature (e.g., to 16-20°C) can mitigate this issue by slowing production and allowing proper folding and membrane insertion.

Proper membrane integration is essential for trg function but can be problematic in recombinant systems. This challenge can be addressed by co-expressing chaperones like DnaK/DnaJ or using E. coli strains with enhanced membrane protein expression capabilities, such as C41(DE3) or C43(DE3). Furthermore, improper post-translational modifications can hinder function, as trg requires specific methylation patterns for normal activity . Ensuring the expression host contains functional CheR and CheB proteins is critical for proper modification.

Finally, researchers often observe poor incorporation into chemoreceptor arrays, which is essential for function . This can be improved by co-expressing other components of the chemotaxis machinery (CheA, CheW) or by carefully controlling the expression levels of trg to match physiological ratios with other chemoreceptors. Verification of functional expression should include both localization studies (e.g., fluorescent tagging) and functional assays (e.g., chemotaxis assays) to confirm that the recombinant protein behaves like the native counterpart .

How can researchers interpret conflicting data regarding trg protein function in different experimental systems?

Interpreting conflicting data regarding trg protein function across different experimental systems requires systematic analysis of potential variables. Expression level differences often contribute to discrepancies, as both insufficient and excessive expression can alter function . Researchers should quantify expression using western blots or fluorescence measurements when comparing systems. Host strain variation represents another critical factor, as strain-specific differences in chemotaxis pathway components can influence trg function. Complete characterization of the genetic background, particularly regarding chemotaxis genes, helps identify potential interaction effects.

Post-translational modification status significantly impacts function, with methylation and CheB-modification playing key roles . Analyzing these modifications through techniques like mass spectrometry or mobility shift assays can reveal whether differences in modification explain functional discrepancies. Experimental conditions such as growth phase, media composition, and temperature can alter chemotaxis behavior and should be standardized across comparisons.

When conflicts persist despite controlling these variables, researchers should consider complementary approaches to validate findings. For instance, if in vivo and in vitro results conflict, developing intermediate reconstitution systems might bridge the gap. Creating a comparative table of experimental conditions, genetic backgrounds, and key findings across studies helps visualize potential sources of variation. Finally, mathematical modeling of the chemotaxis system under different parameter conditions can sometimes predict and explain apparently conflicting experimental observations by revealing how system behavior changes across different parameter regimes .

What statistical approaches are most appropriate for analyzing chemotaxis data in experiments involving recombinant trg protein?

Analyzing chemotaxis data requires appropriate statistical approaches tailored to the specific assay type and experimental design. For capillary assays, where the dependent variable is typically cell count, data often follow a Poisson distribution. Therefore, generalized linear models with a Poisson or negative binomial distribution are more appropriate than standard ANOVA when comparing multiple conditions. When analyzing swim plate assays, the measured colony diameter expansion rates should be compared using repeated measures ANOVA to account for the time-series nature of the data.

For microfluidic or single-cell tracking experiments, the resulting data are more complex and multidimensional. Parameters such as run speed, tumble frequency, and directional bias can be extracted and analyzed separately. Mixed-effects models are particularly valuable for these datasets as they can account for both fixed effects (experimental conditions) and random effects (variation between individual cells or experimental runs).

To account for the inherent biological variability in chemotaxis experiments, researchers should perform at least three biological replicates (using independent cultures) with multiple technical replicates within each. Power analysis should be conducted prior to experimentation to determine appropriate sample sizes. The presentation of results should include both the effect size (magnitude of difference between conditions) and measures of statistical significance. When comparing recombinant trg variants to wild-type controls, Dunnett's test is preferred over multiple t-tests as it controls the family-wise error rate while specifically comparing each variant to the control . For complex datasets involving multiple variables, multivariate approaches such as principal component analysis can help identify patterns and relationships that might not be apparent in univariate analyses.

How can researchers distinguish between effects due to trg protein function versus indirect effects in recombinant systems?

Distinguishing between direct trg protein effects and indirect effects in recombinant systems requires carefully designed control experiments and analytical approaches. Domain-swapping experiments, where individual domains of trg are exchanged with corresponding domains from other MCPs, can help isolate function-specific effects. By creating chimeric proteins that contain only specific portions of trg, researchers can attribute observed phenotypes to particular domains.

Point mutations targeting specific functional residues provide another powerful approach. Mutations in the ligand-binding domain should affect chemotaxis toward specific attractants without altering basal signaling, while mutations in the signaling domain should have broader effects on chemotactic function. Comparing these phenotypes helps differentiate between direct signaling effects and indirect consequences of protein expression.

Inducible expression systems allow for titration of trg protein levels, enabling researchers to establish dose-response relationships between expression and phenotype. A true functional effect should show a consistent relationship with expression level, while indirect effects often show threshold behavior. Time-resolved experiments, where trg expression is induced and phenotypes are monitored over time, can reveal the temporal relationship between expression and functional consequences.

Genetic background controls are particularly important. Expressing recombinant trg in both wild-type and Δtrg backgrounds helps differentiate between complementation of missing function and dominant effects of the recombinant protein . Similarly, expressing non-functional trg variants (e.g., with mutations in critical signaling residues) at the same level as functional variants controls for general consequences of protein expression unrelated to signaling activity. These complementary approaches provide a comprehensive framework for distinguishing genuine functional effects from artifacts in recombinant systems.

What is the significance of comparison tables for functional analyses of wild-type versus recombinant trg protein variants?

Comparison tables serve as essential tools for systematically evaluating the functional characteristics of wild-type versus recombinant trg protein variants. These tables should include multiple parameters such as expression levels, methylation patterns, subcellular localization, and quantitative chemotaxis metrics for each variant tested. The following table illustrates a typical framework for such comparisons:

ParameterWild-type trgRecombinant trg (native promoter)Recombinant trg (inducible promoter)trg-mCherry fusion
Expression level (relative units)1.00.8-1.21.5-3.00.7-0.9
Membrane localization (% of total)>95%>90%75-85%80-90%
Polar clustering (% of cells showing foci)>80%70-80%50-60%50-70%
Methylation level (relative units)1.00.9-1.10.7-0.90.8-1.0
Chemotactic ratio toward specific attractants8.5 ± 1.27.8 ± 1.55.2 ± 1.86.3 ± 1.4
CheA activation in vitro (% of wild-type)100%90-95%70-80%75-85%

This comparative approach allows researchers to identify specific functional deficiencies in recombinant variants and correlate them with structural or expression differences . For instance, the table above reveals that while the natively-promoted recombinant trg maintains near-wild-type functionality, the inducibly expressed variant shows reduced membrane localization, clustering, and chemotactic efficiency despite higher expression levels. Such insights guide optimization strategies and help distinguish between effects caused by expression level differences versus intrinsic functional alterations in the recombinant protein.

How should researchers interpret methylation pattern differences between native and recombinant trg proteins?

Interpreting methylation pattern differences between native and recombinant trg proteins requires consideration of both technical and biological factors. Methylation patterns are typically visualized using SDS-PAGE mobility shifts or mass spectrometry analysis of methylated residues . When differences are observed, researchers should first verify that the expression host contains functional methylation machinery (CheR methyltransferase and CheB methylesterase) as these enzymes are essential for establishing proper modification patterns .

Differences in the distribution of methylation states often reflect altered adaptation kinetics in the recombinant system. Native trg typically exists in multiple methylation states, with the distribution shifting in response to attractant or repellent exposure . If recombinant trg shows a skewed distribution—for example, predominantly in highly methylated forms—this may indicate persistent activation of the adaptation system, possibly due to improper folding or membrane insertion causing a locked signaling state similar to that observed in cheD mutants .

Quantitative differences in methylation levels can be analyzed by comparing the relative intensities of differently migrating bands on gels or by quantifying methylated peptides in mass spectrometry data. These differences should be correlated with functional assays to determine their significance. For instance, reduced methylation might correlate with diminished adaptation capability in prolonged exposure to attractants, while inappropriate hypermethylation might result in reduced sensitivity to new stimuli . By systematically mapping these correlations, researchers can establish which methylation differences represent functional deficiencies requiring correction versus minor variations with minimal impact on chemotactic behavior.

What emerging technologies might enhance our understanding of recombinant trg protein function in synthetic biology applications?

Emerging technologies are poised to transform our understanding and application of recombinant trg protein in synthetic biology. CRISPR-Cas systems offer unprecedented precision for genomic integration of modified trg variants, enabling creation of stable recombinant strains with single-copy expression from the native genomic locus . This approach minimizes artifacts associated with plasmid-based expression while allowing precise engineering of the protein and its regulatory elements.

Microfluidic technologies with integrated biosensors provide real-time monitoring of chemotactic responses in controlled gradient environments, allowing high-throughput characterization of trg variants. These platforms can simultaneously track thousands of individual bacteria, generating rich datasets for machine learning analysis to identify subtle phenotypic differences between variants. Optogenetic control systems, where light-sensitive domains are integrated into trg or its signaling partners, enable temporal and spatial control of chemotaxis signaling, opening new possibilities for studying pathway dynamics and creating bacteria with programmable movement patterns .

Single-molecule tracking microscopy techniques can visualize the dynamics of individual trg molecules within the membrane, revealing how they incorporate into arrays and interact with other components of the chemotaxis machinery . Complementary to this, cryo-electron tomography continues to improve in resolution, providing increasingly detailed structural information about chemoreceptor arrays containing recombinant trg variants . These technological advances collectively promise to deepen our mechanistic understanding of trg function while enabling more sophisticated synthetic biology applications, such as bacteria engineered to detect and respond to environmental pollutants or disease biomarkers .

How might recombinant trg protein be engineered to detect novel ligands for environmental or biomedical applications?

Engineering recombinant trg protein to detect novel ligands represents a frontier in both environmental monitoring and biomedical sensing applications. The most direct approach involves domain swapping, where the periplasmic sensing domain of trg is replaced with ligand-binding domains from other receptors or proteins with affinity for the target compound . For instance, integrating peptide-binding domains can create bacteria responsive to specific biomarkers, while incorporating metal-binding motifs might enable detection of environmental contaminants .

Directed evolution offers a complementary strategy, where random mutagenesis of the sensing domain is coupled with selection for bacteria that respond to the target ligand. This approach requires development of clever selection schemes, such as linking chemotaxis toward the target compound to bacterial survival or growth advantage. Computational protein design represents an increasingly powerful method, where in silico modeling predicts mutations likely to create binding pockets for specific targets. These predictions can guide targeted mutagenesis efforts, reducing the experimental burden compared to random approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.