Recombinant Escherichia coli Molybdenum transport system permease protein modB (modB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
modB; chlJ; b0764; JW0747; Molybdenum transport system permease protein ModB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
modB
Target Protein Sequence
MILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCTFPGKALLDSVLHLPLVLPPV VVGYLLLVSMGRRGFIGERLYDWFGITFAFSWRGAVLAAAVMSFPLMVRAIRLALEGVDV KLEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGEFGATITFVSNIPGETRT IPSAMYTLIQTPGGESGAARLCIISIALAMISLLISEWLARISRERAGR
Uniprot No.

Target Background

Function
This protein plays a role in the binding-protein-dependent transport system for molybdenum. It is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ModB and what is its role in bacterial cells?

ModB is an integral membrane protein that functions as the permease component of the high-affinity molybdate transport system in Escherichia coli and other bacteria. It works in conjunction with ModA (a periplasmic binding protein) and ModC (an energizer protein) to facilitate the uptake of molybdate (MoO4²⁻) from the environment. The ModABC system represents one of the most efficient substrate transport mechanisms in bacteria, with a remarkably high affinity for molybdate (Km value of approximately 50 nM) . This transport system is crucial because molybdenum is an essential cofactor for various enzymes involved in nitrogen, carbon, and sulfur metabolism.

How is the molybdate transport system organized genetically in E. coli?

In E. coli, the molybdate transport system is encoded by the modABCD operon. The modA gene encodes the periplasmic binding protein, modB encodes the integral membrane permease protein, modC encodes the energizer protein (an ATPase), and modD encodes an accessory protein. This genetic organization allows for coordinated expression of all components of the transport system. The operon is regulated by a repressor protein called ModE, which acts as a molybdate sensor. When ModE binds to molybdate, it forms a complex that binds to specific DNA sequences (TAYAT, where Y = T or C) in the operator/promoter region, preventing transcription of the modABCD operon .

What techniques are commonly used to express recombinant ModB for research?

Expression of recombinant ModB typically involves cloning the modB gene into an expression vector with an appropriate promoter system (such as T7 or arabinose-inducible promoters). Since ModB is an integral membrane protein, specialized expression systems are often required. Common approaches include:

  • Using E. coli strains optimized for membrane protein expression (C41/C43 or Lemo21)

  • Adding fusion tags (His-tag, MBP, etc.) to facilitate purification

  • Optimizing growth conditions (temperature, induction time, media composition)

  • Expression in cell-free systems for challenging membrane proteins

Purification typically involves detergent solubilization followed by affinity chromatography and size exclusion chromatography to maintain protein stability and functionality.

What structural features of ModB are critical for its permease function?

ModB contains multiple transmembrane domains that form a channel through which molybdate passes from the periplasm into the cytoplasm. Key structural features include:

  • Transmembrane helices that span the cytoplasmic membrane

  • Conserved charged residues within the transmembrane domains that facilitate ion transport

  • Cytoplasmic domains that interact with the ModC ATPase

  • Periplasmic loops that interact with the ModA binding protein

Understanding these structural elements requires techniques such as X-ray crystallography, cryo-EM, or molecular dynamics simulations. Mutational analysis targeting specific residues can identify those critical for substrate binding, transport, or protein-protein interactions within the ModABC complex .

How does the ModB protein interact with other components of the molybdate transport system?

ModB interacts directly with both ModA and ModC to form a functional transport complex. The current model suggests that:

  • ModA binds molybdate in the periplasm and undergoes a conformational change

  • The ModA-molybdate complex docks with ModB

  • ModB interacts with ModC, which hydrolyzes ATP to provide energy

  • This energy drives conformational changes in ModB that open a channel for molybdate transport

  • Molybdate is released into the cytoplasm

Research approaches to study these interactions include co-purification experiments, bacterial two-hybrid assays, FRET analysis, and structural studies of the assembled complex. Cross-linking experiments can also identify specific interaction domains between the proteins .

What experimental approaches can reliably measure the kinetics of ModB-mediated molybdate transport?

Several complementary approaches can be used to measure ModB-mediated molybdate transport kinetics:

  • Radioactive molybdate (⁹⁹Mo) uptake assays in intact cells or reconstituted liposomes

  • Fluorescence-based transport assays using molybdate-sensitive fluorophores

  • Isothermal titration calorimetry (ITC) to measure binding affinities

  • Electrophysiological techniques for real-time measurement of ion transport

  • Surface plasmon resonance to measure ModA-ModB interaction kinetics

When designing these experiments, it's crucial to account for alternative low-affinity transport systems such as the sulfate transport system, which can transport molybdate in mod mutants. Using mod mutants as negative controls and sulfate transport mutants as additional controls can help isolate ModB-specific transport activity .

How is the expression of modB regulated in response to environmental conditions?

The modB gene expression is primarily regulated by the repressor protein ModE in response to intracellular molybdate levels. The regulation mechanism involves:

  • Under high molybdate conditions: ModE binds molybdate, and the ModE-molybdate complex binds to operator sequences (TAYAT) as a homodimer, repressing transcription of the modABCD operon

  • Under low molybdate conditions: ModE is inactive, allowing transcription of the mod genes

Additional regulatory factors include:

  • Oxygen levels: anaerobic conditions can influence mod gene expression through global regulators

  • Nitrogen availability: nitrogen limitation can affect expression via nitrogen regulatory systems

  • Growth phase: expression levels change during different growth phases

Research methods to study this regulation include reporter gene assays (lacZ fusions), quantitative RT-PCR, ChIP-seq to identify ModE binding sites, and transcriptomics to examine global expression patterns under various conditions .

What approaches can be used to create and validate modB mutants for functional studies?

Creating and validating modB mutants involves several complementary techniques:

  • Site-directed mutagenesis targeting specific residues predicted to be important for function

  • CRISPR-Cas9 genome editing for chromosomal modifications

  • Transposon mutagenesis for random insertions

  • Deletion mutants created by homologous recombination

  • Point mutations identified through directed evolution approaches

Validation methods include:

  • Complementation assays to confirm phenotypes are specifically due to modB mutations

  • Molybdate transport assays to measure functional consequences

  • Western blotting to confirm expression levels

  • Localization studies using GFP fusions or subcellular fractionation

  • Growth phenotypes in molybdate-limited conditions

  • Activity assays for molybdoenzymes that depend on molybdate transport

A recent study employed CRISPR-Cas9 technology to generate a T4 phage expressing catalytically inactive ModB(R73A, G74A), demonstrating the importance of these residues for ModB activity .

What is the newly discovered RNAylation activity of ModB and how is it studied?

Recent research has revealed that ModB possesses ADP-ribosyltransferase activity that can attach RNA chains to host proteins, a process termed "RNAylation." This novel function appears to be independent of its role in molybdate transport. Key aspects of this activity include:

  • ModB can transfer RNA chains from NAD-capped RNAs to specific target proteins

  • Target proteins include ribosomal protein S1 (rS1) and ribosomal protein L2 (rL2)

  • The reaction involves transfer of the RNA from the NAD cap to the protein target

Methods to study this activity include:

  • In vitro RNAylation assays using purified ModB and NAD-capped RNA substrates

  • RNAylomeSeq approach to identify RNAs linked to proteins by ModB

  • MS analysis to identify RNAylated proteins

  • Fluorescently labeled RNA substrates to track RNAylation in cell lysates

  • Mutagenesis studies to identify residues critical for RNAylation activity

The R73A, G74A mutations in ModB were found to abolish this catalytic activity, providing a valuable negative control for experiments .

How does ModB function during phage infection of E. coli?

ModB appears to play a significant role during bacteriophage infection of E. coli, particularly for T4 phages. Recent findings indicate:

  • T4 phages that express catalytically inactive ModB mutants (R73A, G74A) demonstrate decreased burst size and slowed lysis of E. coli

  • During infection, ModB RNAylates specific host proteins, including ribosomal proteins rS1 and rL2

  • Both bacterial and phage transcripts can be substrates for ModB-mediated RNAylation

  • RNAylation occurs even in the presence of excess NAD (700-fold more NAD than NAD-RNA)

Research approaches to study this phenomenon include:

  • Comparison of wild-type and ModB-mutant phage infection dynamics

  • Proteomic analysis to quantify ModB levels during infection

  • RNAylomeSeq to identify RNAs linked to proteins during infection

  • Functional assays to determine the effects of RNAylation on target protein activity

  • Time-course experiments to track the progression of RNAylation during infection

How conserved is ModB across different bacterial species and what implications does this have?

ModB proteins are highly conserved across various bacterial species, suggesting fundamental importance for bacterial physiology. Comparative analysis shows:

OrganismModB Similarity to E. coliKey Distinctive Features
Escherichia coliReferenceWell-characterized molybdate transport system
Haemophilus influenzaeHigh similaritySimilar structural organization
Azotobacter vinelandiiHigh similarityContains molybdenum storage protein in addition to transport system
Rhodobacter capsulatusHigh similarityRequires two ModE homologues (MopAB proteins) for repression
Klebsiella pneumoniaeHigh similarityTight coupling of molybdate transport to utilization

This conservation suggests that:

  • The basic mechanism of molybdate transport is evolutionarily ancient

  • The core structural and functional features of ModB are essential across species

  • Species-specific adaptations exist in regulatory mechanisms and accessory components

Research approaches include comparative genomics, phylogenetic analysis, heterologous expression studies, and functional complementation tests between species .

What experimental systems can be used to study the interaction between ModB and antimicrobial resistance?

Studying potential connections between ModB and antimicrobial resistance requires specialized experimental approaches:

  • Construction of modB deletion or overexpression strains and assessment of their antimicrobial susceptibility profiles

  • Investigation of potential interactions between ModB and biofilm formation, which is known to contribute to antimicrobial resistance

  • Analysis of cyclic di-GMP signaling in modB mutants, as this second messenger regulates both biofilm formation and virulence

  • Transcriptomic and proteomic profiling of modB mutants to identify changes in expression of genes involved in antimicrobial resistance

  • In vitro evolution experiments to determine if modB mutations arise under antibiotic selection pressure

These approaches can help address open questions regarding the contribution of biofilm formation and cyclic di-GMP signaling to antimicrobial resistance phenotypes in E. coli, as highlighted in recent literature .

What are the major challenges in purifying functional recombinant ModB protein and how can they be overcome?

Purifying functional ModB presents several challenges typical of integral membrane proteins:

  • Low expression levels in conventional systems

  • Protein misfolding and aggregation

  • Difficulty in extracting from membranes without denaturation

  • Maintaining stability during purification

  • Assessing functional activity in vitro

Solutions include:

  • Using specialized E. coli strains (C41, C43, Lemo21) designed for membrane protein expression

  • Optimizing growth conditions (reduced temperature, mild induction)

  • Testing multiple detergents for solubilization (DDM, LMNG, digitonin)

  • Employing lipid nanodiscs or amphipols to maintain native-like environment

  • Adding stabilizing ligands during purification

  • Using fusion partners that enhance solubility and stability

  • Reconstituting purified protein into liposomes for functional assays

Success can be validated through binding assays, ATPase activity measurements (in complex with ModC), and transport assays in proteoliposomes.

What specialized techniques are required to study ModB-mediated RNAylation in experimental settings?

The newly discovered RNAylation activity of ModB requires specialized techniques for investigation:

  • Synthesis of NAD-capped RNA substrates:

    • In vitro transcription with NAD as a transcription initiator

    • Chemical synthesis methods

    • Enzymatic capping of 5'-monophosphorylated RNAs

  • Detection of RNAylated proteins:

    • Fluorescently labeled RNA substrates for visualization

    • Immunoblotting with antibodies against RNA modifications

    • Mass spectrometry to identify modified residues

    • Mobility shift assays to detect RNA-protein conjugates

  • Functional analysis:

    • RNAylomeSeq approach to identify RNAs linked to specific proteins

    • Purification of His-tagged target proteins (like rS1) to capture attached RNAs

    • On-bead reverse transcription and PCR amplification of attached RNAs

    • Next-generation sequencing to identify the RNA species

  • Quantification methods:

    • Kinetic analysis of RNAylation reactions

    • Competition assays between NAD and NAD-RNA

    • Determination of substrate specificity and enzyme efficiency

These techniques have been successfully applied to demonstrate that ModB RNAylates specific target proteins even in conditions that approximate the cellular environment, with NAD present in 700-fold excess over NAD-RNA .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.