Recombinant Escherichia coli MscS family inner membrane protein YnaI (ynaI)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli MscS Family Inner Membrane Protein YnaI

Recombinant Escherichia coli MscS family inner membrane protein YnaI is a mechanosensitive channel protein that plays a crucial role in maintaining cellular osmotic balance. It belongs to the MscS-like channel family, which includes several paralogs in Escherichia coli, such as MscS and MscL. These proteins are essential for responding to mechanical stress on the cell membrane, allowing ions and small molecules to flow out of the cell to prevent lysis under osmotic shock conditions.

Structure and Function

YnaI is structurally distinct from its well-studied counterpart, MscS. Unlike MscS, which has three transmembrane helices, YnaI contains five transmembrane helices, contributing to its unique gating mechanism and structural features . The membrane domain of YnaI is funnel-shaped, with a narrower cytosolic end (8 nm in diameter) and a wider periplasmic end (12.5 nm in diameter), compared to MscS . This structural arrangement results in a larger membrane domain thickness and a more complex pore structure.

FeatureYnaIMscS
Transmembrane Helices53
Cytosolic Diameter8 nm8 nm
Periplasmic Diameter12.5 nm5.5 nm
Membrane Domain Thickness7.5 nm4.5 nm

Gating Mechanism

The gating mechanism of YnaI differs significantly from that of MscS. While MscS is activated by lysophosphatidylcholine (LPC) through membrane tension, YnaI requires higher membrane tension to open and exhibits smaller conductivity compared to other MscS-like channels . This suggests that YnaI may play a specialized role in osmotic protection, potentially allowing fewer solutes to exit the cell.

Research Findings

Recent studies have utilized cryo-electron microscopy (cryo-EM) to elucidate the structure of YnaI. These studies reveal that YnaI exists in multiple conformations, including closed-like and open-like states, with variations in pore diameter and periplasmic indentation . The presence of native lipids, such as phosphatidylethanolamine, in the hydrophobic pockets of YnaI's transmembrane domain suggests a role for lipids in stabilizing the channel's structure .

Recombinant Production and Applications

Recombinant YnaI proteins are produced for research purposes, often using Escherichia coli as the host organism. These proteins are available in various quantities and are stored in Tris-based buffers with glycerol to maintain stability . Recombinant YnaI is used in studies related to mechanosensitive channels and can be applied in vaccine development and biotechnological research.

Product DetailsDescription
Source OrganismEscherichia coli (strain K12)
Protein Sequence1-343 amino acids
Storage Conditions-20°C or -80°C
ApplicationsResearch, vaccine development

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ynaI; b1330; JW1323; Low conductance mechanosensitive channel YnaI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ynaI
Target Protein Sequence
MIAELFTNNALNLVIIFGSCAALILMSFWFRRGNRKRKGFLFHAVQFLIYTIIISAVGSI INYVIENYKLKFITPGVIDFICTSLIAVILTIKLFLLINQFEKQQIKKGRDITSARIMSR IIKITIIVVLVLLYGEHFGMSLSGLLTFGGIGGLAVGMAGKDILSNFFSGIMLYFDRPFS IGDWIRSPDRNIEGTVAEIGWRITKITTFDNRPLYVPNSLFSSISVENPGRMTNRRITTT IGLRYEDAAKVGVIVEAVREMLKNHPAIDQRQTLLVYFNQFADSSLNIMVYCFTKTTVWA EWLAAQQDVYLKIIDIVQSHGADFAFPSQTLYMDNITPPEQGR
Uniprot No.

Target Background

Function
Mechanosensitive channel protecting cells against hypoosmotic stress when highly overexpressed.
Gene References Into Functions
  1. High-level expression of YnaI proteins from a multicopy plasmid in the Δ7 strain (MJFGH) confers significant protection against hypoosmotic shock. PMID: 22874652
Database Links
Protein Families
MscS (TC 1.A.23) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the physiological function of YnaI in E. coli?

YnaI functions as an osmoprotective channel in E. coli, responding to mechanical forces exerted on the cell membrane. Like other members of the MscS family, it plays a vital role in regulating chemical equilibrium within cells by sensing membrane tension. YnaI is one of six osmoprotective paralogs in E. coli with different numbers of transmembrane helices, each fine-tuning the osmoregulatory response . When activated by membrane tension during hypoosmotic shock, these channels open to release small solutes, thereby preventing cell lysis. YnaI's distinct structural features suggest it has specific tension-sensing properties that complement other mechanosensitive channels in the bacterial osmoprotective system .

How does the pore structure of YnaI influence its conductance properties?

The pore of YnaI is formed by TM5 helices and has a minimal diameter of approximately 13-14 Å in its closed state, as determined by cryo-EM studies . Access to the pore is through a vestibule on the cytosolic side that is fenestrated by side portals. In YnaI, these portals are obstructed by aromatic side chains but remain fully hydrated, supporting conductance . The gating mechanism involves relocation of the sensor paddle relative to the pore, concomitant with bending of a GGxGG motif in the pore helices. Notably, YnaI is the only one of the six MscS paralogs in E. coli that possesses this GGxGG motif, which allows the sensor paddle to move outward during gating . Comparative analysis with MscS and YbiO has highlighted differences in hydrophobicity and wettability of their pores and vestibule interiors, explaining their fine-tuned conductive properties .

What are the most effective methods for extracting and purifying recombinant YnaI?

Several detergent-free approaches have proven effective for extracting and purifying YnaI while preserving its native structure. The membrane-active polymer SMA2000 (styrene-maleic acid copolymer) has been successfully used to extract YnaI directly from E. coli membranes. The protocol involves:

  • Isolation of cell membrane by ultracentrifugation (250,000× g for 1 hour at 4°C)

  • Resuspension of membrane fraction in buffer and homogenization

  • Incubation with SMA2000 at 2.5% (w/v) for 2 hours at 20°C

  • Removal of insoluble material by ultracentrifugation

  • Purification using Ni-NTA column chromatography

  • Size exclusion chromatography using a Superose 6 increase column

Alternatively, the diisobutylene/maleic acid (DIBMA) copolymer can be used to extract YnaI in native nanodiscs, which has allowed structural studies of both closed-like and open-like conformations . Both methods preserve the protein-lipid interactions essential for understanding YnaI's structure and function .

What expression systems yield the highest amounts of functional YnaI protein?

While the search results don't provide specific yield comparisons, they indicate that recombinant expression in E. coli is effective for producing YnaI for structural studies. Interestingly, recent innovative approaches for recombinant protein production in E. coli have been developed that export diverse proteins in membrane-bound vesicles . This system was discovered when researchers observed that expression of human α-synuclein (αSyn) in E. coli resulted in the release of extracellular αSyn-containing membrane vesicles . This approach could potentially be adapted for YnaI production, especially since YnaI is a native E. coli membrane protein.

For standard expression, constructs typically include a His-tag to facilitate purification by Ni-NTA affinity chromatography, as evidenced by the purification protocol described in the literature . The expression and purification yielded protein of sufficient quality and quantity for cryo-EM studies, as demonstrated by the high-quality structural data obtained (MolProbity score of 1.72, Ramachandran favored 93.64%) .

How can I assess the functional integrity of purified YnaI channels?

The functional integrity of purified YnaI can be assessed through a combination of structural and functional approaches:

  • Structural integrity assessment:

    • Cryo-EM analysis to confirm the heptameric assembly and proper folding

    • Size exclusion chromatography to verify oligomeric state

    • Validation metrics such as MolProbity score (1.72) and Ramachandran statistics (93.64% most favored, 6.36% allowed) for structural quality

  • Functional characterization:

    • Reconstitution into liposomes or planar lipid bilayers for electrophysiology measurements

    • Tension sensitivity assays to evaluate mechanosensitive properties

    • Comparison of conductance properties with previously characterized values

    • Assessment of the pore diameter (approximately 13-14 Å in closed state)

  • Lipid interaction analysis:

    • Verification of native lipid co-purification, as these are critical for proper function

    • HINT scoring analysis to evaluate lipid contribution to system stabilization (approximately 14 kcal mol⁻¹)

What is known about the gating mechanism of YnaI and how does it differ from other MscS family channels?

YnaI employs a distinct gating mechanism compared to other MscS family channels. The key features of YnaI's gating mechanism include:

  • GGxGG motif-dependent bending: YnaI contains a unique GGxGG motif in the pore helices that enables bending during the gating process. This motif is found only in YnaI among the six E. coli MscS paralogs .

  • Sensor paddle relocation: During gating, the extended sensor paddle of YnaI relocates relative to the pore. This movement occurs concomitantly with the bending of the GGxGG motif in the pore helices .

  • Outward movement capability: The presence of the GGxGG motif allows the sensor paddle to move outward during channel opening .

In contrast, YbiO (a larger MscS family member with 11 TM helices) lacks the GGxGG motif and shows different gating properties, with larger portals and a wider pore . MscS itself has a different architecture with only three TM helices and employs a distinct gating mechanism. These structural and mechanistic differences highlight the evolutionary diversification within the MscS family that allows for fine-tuned responses to mechanical stress .

What role do native lipids play in YnaI structure and function?

Native lipids play a crucial role in maintaining the proper structure and function of YnaI:

  • Structural stabilization: Cryo-EM structures of YnaI extracted with SMA2000 revealed seven potential lipid molecules bound in hydrophobic pockets defined by TMs 4-5 and the cytoplasmic region. These lipids, predominantly phosphatidylethanolamine (PE), contribute approximately 14 kcal mol⁻¹ to system stabilization according to HINT scoring analysis .

  • Conformational impact: The presence and orientation of lipid molecules dramatically affect the transmembrane region structure. Different orientations of the phospholipid head can cause drastic changes in TM4, resulting in completely different orientations of this alpha-helix .

  • Functional modulation: The lipid-protein interactions are likely to influence the tension sensitivity and gating properties of YnaI. The "hook lipids" and "pore lipids" bound to the transmembrane domain are particularly important for understanding the gating mechanism .

Current extraction methods (including DIBMA, SMALP, and NCMN systems) still face challenges in retaining all crucial lipid molecules that interact with YnaI, presenting an ongoing challenge for fully understanding its gating mechanism .

What are the key structural differences between open and closed conformations of YnaI?

The structural transition between closed and open conformations of YnaI involves several key differences:

  • Pore diameter: In the closed state, YnaI has a minimal pore diameter of approximately 13-14 Å, formed by TM5a helices . This expands significantly in the open conformation to allow ion and solute passage.

  • GGxGG motif bending: The transition involves bending of the GGxGG motif in the pore helices, which is unique to YnaI among E. coli MscS paralogs .

  • Sensor paddle movement: The extended sensor paddle, formed by the additional TM helices, relocates relative to the pore during gating. This movement occurs concomitantly with the bending of the pore helices .

  • Side portal configuration: YnaI has side portals that are obstructed by aromatic side chains in the closed state but remain fully hydrated. The configuration of these portals changes during gating to facilitate conductance .

  • Transmembrane helix rearrangement: The transition involves rearrangement of the transmembrane helices, particularly TM4 and TM5, which are the most well-resolved in cryo-EM structures .

The structural studies using DIBMA have captured YnaI in both closed-like and open-like conformations, providing valuable insights into these transitions .

How does the tension sensitivity of YnaI compare to other mechanosensitive channels in E. coli?

Experimentally, YnaI has far different tension sensitivity compared to other MscS family members in E. coli, reflecting its specialized role in the osmoregulatory response. The comparative tension sensitivity of E. coli mechanosensitive channels can be understood in the context of their structural differences:

  • Sensor paddle architecture: YnaI possesses an extended sensor paddle with additional TM helices compared to MscS, which likely influences its tension sensitivity. The staggered arrangement of these helices toward the periplasm may provide a distinct mechanical response to membrane deformation .

  • Gating threshold hierarchy: In E. coli, mechanosensitive channels typically operate in a hierarchy, with MscL (mechanosensitive channel of large conductance) activating at higher tension thresholds than MscS, which in turn activates at higher thresholds than MscK. YnaI fits into this hierarchy with its own characteristic activation threshold .

  • Structural implications: The presence of the GGxGG motif in YnaI, which is absent in other paralogs, suggests a unique mechanism for sensing and responding to membrane tension. This molecular feature allows for specific paddle movements during gating that differ from other MscS family members .

The structural and mechanistic conservation within the MscS family, combined with these distinctive features, explains how YnaI contributes to the finely tuned spectrum of mechanosensitive responses in E. coli .

What evolutionary insights can be gained from comparing YnaI with other MscS family proteins?

Evolutionary analysis of YnaI and other MscS family members reveals important insights about mechanosensation across species:

  • Core architecture conservation: Despite considerable diversity in the MscS family, the basic architecture of the core is conserved across members. YnaI represents an intermediate complexity between the simpler MscS (3 TM helices) and the more complex YbiO (11 TM helices) .

  • Functional diversification: The structural variation within the family provides a wider range of cellular functions. This diversity explains why cell-walled organisms often contain several different versions of these channels in the same organism .

  • Mechanistic evolution: While the basic architecture is conserved, the functional properties and gating mechanisms vary significantly. This suggests evolutionary adaptation to different mechanical stresses and cellular requirements .

  • Domain acquisition: The additional transmembrane helices in YnaI and other complex MscS family members likely represent domain acquisitions during evolution that allowed for more sophisticated responses to mechanical stimuli .

This evolutionary diversification has resulted in a family of channels that fine-tunes osmoregulation and potentially fulfills additional functions. Understanding these evolutionary relationships helps explain how structural variations provide a wider range of cellular functions through mechanosensitive channels .

What structural features distinguish YnaI from the larger YbiO and smaller MscS channels?

The structural comparison between YnaI, YbiO, and MscS reveals distinct features that differentiate these MscS family members:

FeatureYnaIYbiOMscS
Transmembrane helices5113
Heptameric assemblyYesYesYes
GGxGG motifPresentAbsentAbsent
Pore diameter (closed)~13-14 ÅWiderComparable
Side portalsObstructed by aromatic side chains but hydratedLargerDifferent configuration
Sensor paddleExtendedMore complexBasic
Gating mechanismBased on GGxGG motif bending and paddle relocationDifferentDifferent

Key distinguishing features:

  • Transmembrane domain complexity: YnaI has an intermediate complexity with 5 TM helices, compared to the simpler MscS (3 TM) and more complex YbiO (11 TM) .

  • Pore and vestibule properties: In silico comparison has highlighted differences in the hydrophobicity and wettability of the pores and vestibule interiors among these three channels, explaining their fine-tuned conductive properties .

  • Portal architecture: YbiO has larger portals compared to YnaI, while YnaI's portals are obstructed by aromatic side chains but remain fully hydrated to support conductance .

  • Gating elements: YnaI uniquely possesses the GGxGG motif that enables its specific gating mechanism, while YbiO and MscS employ different molecular mechanisms for channel opening .

These structural differences explain the functional specialization of each channel within the E. coli osmoregulatory system.

How can recombinant YnaI be utilized in drug discovery or biotechnology applications?

Recombinant YnaI offers several potential applications in drug discovery and biotechnology:

  • Drug delivery systems: The recent discovery that recombinant expression of full-length human α-synuclein in E. coli results in the release of extracellular membrane vesicles suggests that YnaI could potentially be incorporated into similar vesicle-based systems for drug delivery.

  • Biosensor development: As a mechanosensitive channel with well-characterized structural and functional properties, YnaI could be engineered into biosensors for detecting mechanical forces or osmotic changes in various applications.

  • Structural platform for drug screening: The detailed structural information available for YnaI provides a platform for structure-based drug design, particularly for compounds targeting bacterial membrane proteins.

  • Protein production systems: The vesicle-packaged recombinant protein production system described for E. coli could potentially be adapted to use YnaI as a carrier protein for the production of other recombinant proteins of interest.

  • Model system for mechanosensation: YnaI serves as an excellent model system for studying mechanosensation mechanisms, which could inform the development of therapeutics targeting eukaryotic mechanosensitive channels involved in various pathologies.

What are the current limitations in studying YnaI structure-function relationships?

Despite significant advances, several challenges remain in fully understanding YnaI structure-function relationships:

  • Lipid preservation: Current extraction methods (DIBMA, SMALP, NCMN) still struggle to retain all crucial lipid molecules that interact with YnaI, particularly the "hook lipids" and "pore lipids" that are essential for understanding the gating mechanism .

  • Dynamic structural transitions: While structures of closed-like and open-like conformations have been determined, capturing the complete conformational landscape during gating remains challenging. The dynamic nature of these transitions makes them difficult to study with static structural methods .

  • In vivo context: Translating structural insights to the in vivo context, where YnaI functions within a complex membrane environment and alongside other mechanosensitive channels, presents ongoing challenges .

  • Resolution limitations: While high-resolution structures have been obtained for the soluble portion of YnaI, the transmembrane region, particularly TM1-3, has proven more difficult to resolve at high resolution, limiting our understanding of these regions .

  • Functional measurements: Correlating structural states with precise functional measurements remains technically challenging, making it difficult to establish clear structure-function relationships for specific amino acid residues or structural features .

What emerging technologies might advance our understanding of YnaI in the near future?

Several emerging technologies hold promise for advancing YnaI research:

  • Advanced membrane mimetics: Continuing development of detergent-free systems like SMALP, DIBMA, and NCMN may soon enable determination of YnaI structures with all essential lipids intact, providing crucial insights into lipid-protein interactions .

  • Time-resolved cryo-EM: This technique could capture transient conformational states during gating, providing a more complete picture of the dynamic structural changes in YnaI .

  • Computational approaches: Advanced molecular dynamics simulations, incorporating recent structural data, can model membrane tension effects on YnaI and predict conformational changes during gating .

  • Single-molecule FRET: This technique could provide insights into the real-time dynamics of YnaI gating in response to mechanical stimuli, complementing static structural studies .

  • Native mass spectrometry: Improved methods for analyzing membrane protein complexes with their associated lipids could reveal the complete lipid composition of native YnaI assemblies .

  • Genetic approaches: The observation of recombinant transfer in the basic genome of E. coli suggests that genetic engineering approaches could be used to create YnaI variants with altered properties for structure-function studies.

  • Improved extraction methods: Future innovations in membrane protein extraction may overcome current limitations in preserving the native lipid environment, enabling more complete structural studies of YnaI with all essential lipids intact .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.