Recombinant Escherichia coli Multidrug resistance-like ATP-binding protein MdlA (mdlA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please specify it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
mdlA; mdl; b0448; JW0438; Multidrug resistance-like ATP-binding protein MdlA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-590
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
mdlA
Target Protein Sequence
MRLFAQLSWYFRREWRRYLGAVALLVIIAMLQLVPPKVVGIVVDGVTEQHFTTGQILMWI ATMVLIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQHPEFYLRHRTGDLMARA TNDVDRVVFAAGEGVLTLVDSLVMGCAVLIMMSTQISWQLTLFSLLPMPVMAIMIKRNGD ALHERFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSALFAADAEDTGKKNMRVARI DARFDPTIYIAIGMANLLAIGGGSWMVVQGSLTLGQLTSFMMYLGLMIWPMLALAWMFNI VERGSAAYSRIRAMLAEAPVVNDGSEPVPEGRGELDVNIHQFTYPQTDHPALENVNFALK PGQMLGICGPTGSGKSTLLSLIQRHFDVSEGDIRFHDIPLTKLQLDSWRSRLAVVSQTPF LFSDTVANNIALGCPNATQQEIEHVARLASVHDDILRLPQGYDTEVGERGVMLSGGQKQR ISIARALLVNAEILILDDALSAVDGRTEHQILHNLRQWGQGRTVIISAHRLSALTEASEI IVMQHGHIAQRGNHDVLAQQSGWYRDMYRYQQLEAALDDAPENREEAVDA
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily, Drug exporter-2 (TC 3.A.1.117) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MdlA and what is its function in Escherichia coli?

MdlA (Multidrug resistance-like ATP-binding protein) is a component of the ABC transporter superfamily in E. coli. It functions as an ATP-binding protein (EC= 3.6.3.44) involved in multidrug resistance mechanisms. The protein is encoded by the mdlA gene (also known as mdl, ECK0442, or JW0438) and operates as part of a transport system that can export various compounds from the bacterial cell, potentially contributing to antibiotic resistance mechanisms . Understanding this protein's structure and function is crucial for research into bacterial resistance mechanisms and potential therapeutic interventions.

How does MdlA differ from other ABC transporters in E. coli?

MdlA represents a specific subclass within the ABC transporter superfamily. While it shares the characteristic ATP-binding domains common to all ABC transporters, MdlA is distinguished by its substrate specificity and structural organization. It appears as a fused predicted multidrug transporter subunit of the ABC superfamily . Unlike some single-function transporters, MdlA may have broader substrate specificity, allowing it to interact with multiple drug compounds. Research approaches often compare sequence homology and structural predictions between MdlA and other E. coli ABC transporters to identify unique domains that could be targeted in structure-function studies.

What expression systems are most effective for recombinant MdlA production?

Multiple expression systems have been successfully employed for recombinant MdlA production, including E. coli, yeast, baculovirus, and mammalian cell systems . Each system offers distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, rapid growth, cost-effectiveMay form inclusion bodies, limited post-translational modifications
YeastSome post-translational modifications, proper foldingLonger expression time, different codon usage
BaculovirusSuperior folding, post-translational modificationsMore complex setup, higher cost
Mammalian cellsNative-like post-translational modificationsHighest cost, longest production time
Cell-free expressionRapid, avoids toxicity issuesLower yield, higher cost per unit protein

The choice depends on research objectives - E. coli systems are preferred for structural studies requiring high yields, while mammalian systems may be better for functional studies requiring native-like modifications .

How can I optimize MdlA expression using Design of Experiments (DoE) approaches?

Applying DoE methodology to MdlA expression allows systematic optimization of multiple parameters simultaneously. Based on successful implementations with other recombinant proteins in E. coli, a three-factor central composite design approach can be effective . Key factors to optimize include:

  • Temperature (typically testing range: 20-40°C)

  • Inducer concentration (if using arabinose or IPTG-based systems)

  • Induction point (cell density at induction, measured by OD600)

The DoE approach minimizes the number of experiments while allowing statistical analysis of interactions between factors. Responses to measure include MdlA productivity, solubility, and location (cytoplasmic vs. membrane-associated), as well as bacterial physiology markers . Lower temperatures (20-25°C) combined with moderate inducer concentrations often favor proper folding of membrane-associated proteins like MdlA, reducing inclusion body formation and cellular stress responses.

What purification techniques yield the highest purity for recombinant MdlA?

Purification of recombinant MdlA typically employs a multi-stage approach to achieve ≥85% purity as confirmed by SDS-PAGE . For membrane-associated proteins like MdlA, an effective purification strategy involves:

  • Membrane extraction: Using detergents like DDM (n-dodecyl β-D-maltoside) or CHAPS to solubilize the protein from membranes

  • Affinity chromatography: If tagged (often His-tagged), using immobilized metal affinity chromatography (IMAC)

  • Ion exchange chromatography: To separate based on charge properties

  • Size exclusion chromatography: As a polishing step to remove aggregates and achieve final purity

The choice of detergents is critical for maintaining protein stability and activity throughout the purification process. Screening different detergents and buffer conditions is recommended to optimize both yield and functional integrity of the purified MdlA.

How can I verify the structural integrity of purified MdlA?

Verifying the structural integrity of purified MdlA requires multiple complementary techniques:

  • SDS-PAGE analysis: Confirms expected molecular weight and initial purity assessment (target ≥85%)

  • Western blotting: Using anti-MdlA antibodies to confirm identity

  • Circular dichroism (CD): Provides information about secondary structure elements

  • Thermal shift assays: Assess protein stability under different buffer conditions

  • ATPase activity assays: Functional verification of ATP binding and hydrolysis

  • Native PAGE or size exclusion chromatography: Evaluates oligomeric state

A properly folded, functional MdlA should demonstrate characteristic ATPase activity that can be stimulated by transport substrates, confirming both structural and functional integrity.

What methods can be used to study the substrate specificity of MdlA?

Characterizing MdlA substrate specificity involves several complementary approaches:

  • In vitro transport assays: Using inverted membrane vesicles or reconstituted proteoliposomes containing purified MdlA to measure transport of fluorescently labeled or radioactive substrates

  • ATPase activity stimulation: Measuring changes in ATPase activity in the presence of different potential substrates

  • Binding studies: Using techniques like surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to quantify direct binding of substrates

  • Competition assays: Evaluating the ability of unlabeled compounds to compete with a known substrate

  • Mutagenesis studies: Systematically altering potential substrate-binding residues to map the binding pocket

These approaches collectively provide a comprehensive profile of MdlA's substrate specificity, essential for understanding its role in multidrug resistance mechanisms.

How does ATP binding and hydrolysis affect MdlA function?

ATP binding and hydrolysis provide the energy driving substrate transport by MdlA. Research methodologies to study this mechanism include:

  • Site-directed mutagenesis of conserved ATP-binding motifs (Walker A and B motifs)

  • ATP binding assays using fluorescent ATP analogs or radiolabeled ATP

  • Pre-steady-state kinetics to resolve individual steps in the ATP hydrolysis cycle

  • Conformational studies using EPR or FRET to track structural changes during the ATP hydrolysis cycle

  • Vanadate trapping experiments to capture transition-state conformations

Understanding the coupling between ATP hydrolysis and substrate transport is fundamental to elucidating MdlA's mechanism. Typically, ATP binding induces dimerization of the nucleotide-binding domains, causing conformational changes that are transmitted to the transmembrane domains to facilitate substrate translocation across the membrane.

What chromosome engineering techniques are most effective for studying MdlA in E. coli?

For genetic manipulation of mdlA in its native context, several chromosome engineering approaches can be employed:

  • Recombination-based systems: Using λ Red recombinase for precise chromosomal modifications

  • CRISPR-Cas9 based editing: For scarless modifications of the mdlA gene

  • Promoter replacements: To control expression levels of native mdlA

  • Reporter gene fusions: For monitoring expression patterns or localization

  • Introduction of point mutations: To study structure-function relationships

The λ Red recombination system has proven particularly efficient for chromosome engineering in E. coli, allowing precise genetic modifications with relatively high efficiency . This technique allows researchers to create knock-outs, introduce point mutations, or add epitope tags to the native mdlA gene.

How can I design fusion constructs to study MdlA membrane topology and interactions?

Designing effective fusion constructs for MdlA topology and interaction studies requires careful consideration of several factors:

  • Fusion location: N-terminal versus C-terminal tags can differently impact function

  • Tag selection:

    • Fluorescent proteins (GFP, mCherry) for localization studies

    • Split reporter systems (DHFR, β-lactamase) for topology mapping

    • Affinity tags (His, FLAG) for purification and interaction studies

  • Linker design: Flexible linkers (Gly-Ser repeats) to minimize interference with folding

  • Expression control: Inducible promoters with tunable expression levels

  • Validation: Functional assays to ensure fusion proteins retain activity

When designing fusion constructs, it's important to predict membrane topology using bioinformatic tools and validate experimentally. Combining computational prediction with experimental verification using reporter fusions placed at different positions can generate a comprehensive topology map of MdlA in the membrane.

How can I address low expression yields of recombinant MdlA?

Low expression yields of MdlA can stem from multiple causes, each requiring specific interventions:

  • Toxicity issues:

    • Use tightly controlled inducible promoters

    • Employ lower growth temperatures (20-25°C)

    • Consider cell-free expression systems

  • Codon usage bias:

    • Optimize codons for E. coli expression

    • Use strains with additional tRNAs for rare codons

  • mRNA structure issues:

    • Analyze mRNA secondary structure prediction

    • Modify 5' UTR to reduce strong secondary structures

  • Protein folding/stability:

    • Co-express with chaperones (GroEL/ES, DnaK)

    • Reduce induction temperature and inducer concentration

    • Apply DoE approaches to systematically optimize expression conditions

  • Proteolytic degradation:

    • Use protease-deficient strains

    • Include protease inhibitors during extraction

Implementing a DoE approach allows systematic identification of the optimal combination of temperature, inducer concentration, and induction point to maximize functional MdlA expression .

What strategies can overcome protein aggregation during MdlA purification?

Protein aggregation during MdlA purification can be addressed through several strategic approaches:

  • Detergent optimization:

    • Screen multiple detergent types (DDM, LMNG, CHAPS)

    • Test detergent concentrations above CMC

    • Consider detergent mixtures for enhanced stability

  • Buffer optimization:

    • Adjust pH and ionic strength

    • Include stabilizing additives (glycerol, arginine)

    • Test different reducing agents (DTT, TCEP)

  • Purification process adjustments:

    • Maintain low temperature throughout (4°C)

    • Reduce protein concentration during critical steps

    • Include size exclusion chromatography to remove aggregates

    • Consider on-column folding strategies

  • Solubilization aids:

    • Use lipid additives (cholesterol, E. coli lipid extracts)

    • Add specific substrates or nucleotides (ATP/ADP)

    • Test protein stabilizing compounds (DMSO at low concentrations)

Monitoring aggregation throughout purification using dynamic light scattering or analytical size exclusion chromatography provides valuable feedback on the effectiveness of these interventions.

How can MdlA research contribute to understanding antimicrobial resistance mechanisms?

MdlA research provides valuable insights into antimicrobial resistance through several research angles:

  • Substrate profiling: Identifying which antibiotics are MdlA substrates helps predict potential resistance mechanisms

  • Structure-function studies: Understanding binding pocket architecture can guide design of efflux pump inhibitors

  • Regulatory network analysis: Studying how mdlA expression is regulated under antibiotic stress

  • Synergistic effects: Investigating interactions between MdlA and other resistance mechanisms

  • Evolution studies: Comparing MdlA sequences across resistant isolates to identify adaptive mutations

Research methodologies might include:

  • Susceptibility testing of mdlA knockout and overexpression strains to various antibiotics

  • Transcriptomic analysis to identify conditions that upregulate mdlA expression

  • Structural studies (e.g., cryo-EM) to elucidate substrate binding mechanisms

  • Molecular dynamics simulations to predict interactions with various compounds

These approaches collectively enhance our understanding of MdlA's role in antimicrobial resistance and potential strategies to overcome it.

What are the current challenges in structural biology approaches to study MdlA?

Structural biology studies of MdlA face several challenges requiring specialized approaches:

  • Obtaining sufficient quantities: Membrane proteins like MdlA typically express at lower levels than soluble proteins, necessitating optimization of expression systems and purification protocols to obtain milligram quantities required for structural studies .

  • Maintaining native conformations: The conformational dynamics essential to MdlA function make it challenging to capture discrete functional states. Approaches include:

    • ATP/ADP analogs to trap specific conformations

    • Nanobodies or antibody fragments to stabilize conformations

    • Mutagenesis to restrict conformational changes

  • Crystallization challenges: Membrane proteins are notoriously difficult to crystallize due to their hydrophobic surfaces. Alternative approaches include:

    • Lipidic cubic phase crystallization

    • Detergent screening for optimal crystal packing

    • Creating fusion proteins with crystallization chaperones

  • Cryo-EM considerations: While avoiding crystallization, cryo-EM faces challenges with smaller membrane proteins like MdlA:

    • Size enhancement strategies (fusion to larger proteins)

    • Imaging in nanodiscs or amphipols to preserve native environment

    • Classification algorithms to address conformational heterogeneity

  • Functional validation: Ensuring structural data represents physiologically relevant states requires correlating structural findings with functional assays.

Recent advances in single-particle cryo-EM and integrative structural biology approaches are gradually overcoming these challenges, promising new insights into MdlA structure and mechanism.

How should contradictory results in MdlA substrate specificity studies be reconciled?

When facing contradictory results regarding MdlA substrate specificity across different studies, a systematic approach to reconciliation includes:

  • Methodological differences analysis:

    • Compare in vivo vs. in vitro approaches

    • Evaluate differences in detection sensitivity

    • Assess variations in protein preparation techniques

  • Experimental conditions assessment:

    • pH and ionic strength differences

    • Lipid composition variations

    • Temperature effects on binding/transport

  • Construct variations:

    • Presence/absence of tags

    • Full-length vs. truncated constructs

    • Expression system differences

  • Integration strategies:

    • Perform meta-analysis across studies

    • Design experiments specifically addressing contradictions

    • Use orthogonal methods to validate key findings

  • Physiological context consideration:

    • Growth phase dependencies

    • Media composition effects

    • Stress response impacts

This systematic approach helps identify whether contradictions represent actual biological complexities (e.g., condition-dependent substrate preferences) or methodological artifacts.

What bioinformatic approaches can be used to predict MdlA function and regulation?

Modern bioinformatic approaches offer powerful tools for predicting MdlA function and regulation:

  • Sequence-based analyses:

    • Homology modeling based on structural homologs

    • Conserved domain prediction for functional annotation

    • Evolutionary analysis to identify pressure points

  • Structural prediction tools:

    • AlphaFold2/RoseTTAFold for ab initio structure prediction

    • Molecular dynamics simulations for conformational analyses

    • Docking studies to predict substrate binding

  • Genomic context analysis:

    • Operon structure prediction

    • Promoter element identification

    • Transcription factor binding site prediction

  • Systems biology approaches:

    • Network analysis to identify functional partners

    • Pathway enrichment for contextualizing function

    • Integration with transcriptomic/proteomic datasets

  • Machine learning applications:

    • Substrate specificity prediction from sequence

    • Expression level prediction under various conditions

    • Classification of functional variants

These computational approaches generate testable hypotheses that can direct experimental work, creating a virtuous cycle between in silico prediction and experimental validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.