Recombinant Escherichia coli Multidrug resistance-like ATP-binding protein MdlB (mdlB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdlB; mdl; b0449; JW5061; Multidrug resistance-like ATP-binding protein MdlB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
mdlB
Target Protein Sequence
MRSFSQLWPTLKRLLAYGSPWRKPLGIAVLMMWVAAAAEVSGPLLISYFIDNMVAKNNLP LKVVAGLAAAYVGLQLFAAGLHYAQSLLFNRAAVGVVQQLRTDVMDAALRQPLSEFDTQP VGQVISRVTNDTEVIRDLYVTVVATVLRSAALVGAMLVAMFSLDWRMALVAIMIFPVVLV VMVIYQRYSTPIVRRVRAYLADINDGFNEIINGMSVIQQFRQQARFGERMGEASRSHYMA RMQTLRLDGFLLRPLLSLFSSLILCGLLMLFGFSASGTIEVGVLYAFISYLGRLNEPLIE LTTQQAMLQQAVVAGERVFELMDGPRQQYGNDDRPLQSGTIEVDNVSFAYRDDNLVLKNI NLSVPSRNFVALVGHTGSGKSTLASLLMGYYPLTEGEIRLDGRPLSSLSHSALRQGVAMV QQDPVVLADTFLANVTLGRDISEERVWQALETVQLAELARSMSDGIYTPLGEQGNNLSVG QKQLLALARVLVETPQILILDEATASIDSGTEQAIQHALAAVREHTTLVVIAHRLSTIVD ADTILVLHRGQAVEQGTHQQLLAAQGRYWQMYQLQLAGEELAASVREEESLSA
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily, Drug exporter-2 (TC 3.A.1.117) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MdlB and what role does it play in E. coli?

MdlB (Multidrug resistance-like ATP-binding protein B) is a bacterial ATP-binding cassette (ABC) transporter encoded by the mdlB gene in Escherichia coli. This protein is part of the cellular machinery that helps export various compounds from the bacterial cell and contributes to multidrug resistance. MdlB functions similarly to mammalian DT-diaphorase and has been demonstrated to confer resistance to various antibiotics including DMP 840, adriamycin, and etoposide . The protein is characterized by ATP-binding domains essential for its transport function and represents an important component of bacterial defense mechanisms against toxic compounds.

What is the relationship between MdlB and other bacterial MDR proteins?

MdlB belongs to the ABC transporter superfamily, which includes numerous proteins involved in multidrug resistance across different bacterial species. Unlike single-domain transporters, MdlB contains a full transmembrane domain coupled with a nucleotide-binding domain (NBD), making it structurally similar to P-glycoproteins found in eukaryotic cells . The NBD domain contains conserved motifs including Walker A, Walker B, Q-loop, D-loop, and H-loop, which are critical for ATP binding and hydrolysis . These structural features are shared with other bacterial MDR proteins, though MdlB has evolved specific substrate preferences related to its particular role in E. coli drug resistance.

How does the ATP-binding mechanism of MdlB contribute to its drug efflux activity?

The ATP-binding and hydrolysis mechanism of MdlB is central to its function as an efflux transporter. Research indicates that specific amino acid residues within the nucleotide-binding domains (NBDs) are critical for this process. These include Gly681, Cys682, Lys684, Ser685, and Ser686 in the Walker A motif, Glu713 in the Q loop, Asp792 and Asp793 in the D loop, and His827 in the H loop .

ATP binding to these residues triggers conformational changes that power the transport cycle. When designing experiments to study MdlB function, researchers should consider targeting these specific residues through site-directed mutagenesis to evaluate their impact on ATP hydrolysis and substrate transport. Comparative studies with other ABC transporters suggest that the ATP-binding domains work cooperatively, with both NBDs participating in the transport cycle through alternating ATP binding and hydrolysis events that drive substrate translocation across the membrane.

What experimental approaches are most effective for studying MdlB's role in antibiotic resistance?

To effectively study MdlB's role in antibiotic resistance, a multi-faceted approach is recommended:

  • Gene knockout studies: Creating mdlB deletion mutants in E. coli allows direct assessment of its contribution to antibiotic resistance. This approach has been successfully employed in similar studies with other organisms, such as the P-glycoprotein gene knockout in Spodoptera exigua, which demonstrated increased susceptibility to abamectin and emamectin benzoate .

  • Overexpression systems: Recombinant expression of MdlB in various bacterial hosts can help determine if increased protein levels correlate with enhanced resistance to specific antibiotics.

  • Transport assays: In vitro assays using purified MdlB in reconstituted liposomes or membrane vesicles allow measurement of ATP-dependent transport of fluorescently labeled substrates.

  • Molecular docking and MD simulations: Computational approaches similar to those used for MRP1 can identify potential inhibitors that interact with the conserved residues of MdlB's NBD .

  • Crystallography combined with functional assays: Structural studies of MdlB with different substrates or in various conformational states provide insights into the mechanism of transport and substrate specificity.

How can researchers distinguish between MdlB-specific effects and other ABC transporters when studying multidrug resistance in E. coli?

Distinguishing MdlB-specific effects from those of other ABC transporters requires careful experimental design:

  • Specificity controls: Include parallel experiments with knockout/inhibition of other ABC transporters to identify overlapping and distinct phenotypes.

  • Substrate profiling: Determine the substrate specificity profile of MdlB compared to other transporters using a diverse panel of compounds.

  • Expression correlation analysis: Monitor expression levels of multiple ABC transporters under drug selection pressure to identify coregulation patterns.

  • Complementation experiments: Express MdlB in strains lacking other ABC transporters to assess functional compensation.

  • Inhibitor specificity: Employ selective inhibitors that target specific structural features unique to MdlB.

A comprehensive experimental design might include:

Experimental ApproachControl GroupTest GroupMeasurementsExpected Outcomes
Gene knockoutWild-type E. coliΔmdlB mutantMIC for various antibioticsIncreased sensitivity to MdlB-specific substrates
OverexpressionVector-only controlMdlB overexpressionGrowth in presence of antibioticsEnhanced resistance to MdlB substrates
Double knockoutSingle knockout of other ABC transporterDouble knockout with mdlBAntibiotic sensitivity profileSynergistic or additive effects indicate distinct pathways
Selective inhibitionVehicle controlMdlB-specific inhibitorTransport of fluorescent substratesReduced efflux of MdlB-specific substrates only

What is the optimal protocol for cloning and expressing recombinant MdlB protein?

Based on published research, the following protocol has been successfully used for cloning and expressing recombinant MdlB :

Cloning procedure:

  • Amplify the mdlB open reading frame by PCR using E. coli O157:H7 EDL933 genomic DNA as template.

  • Use the following primers:

    • Forward: 5′-AAAAAAGGATCCAGCAACATCCTGATTATCAACGGC

    • Reverse: 5′-AAAAAAGAATTCTTAACCAAAAATTTCCACAAGATGCTT

  • Insert the amplified DNA into a suitable expression vector (e.g., pFO4 plasmid) to yield a His-tagged construct.

  • Verify the construct by sequencing to ensure no mutations were introduced during amplification.

Expression protocol:

  • Transform E. coli BL21(DE3) with the verified construct.

  • Grow transformants in Terrific Broth supplemented with appropriate antibiotic (e.g., ampicillin at 200 µg/ml).

  • Induce protein expression when the culture reaches appropriate density.

  • Harvest cells and purify the recombinant protein using nickel-affinity chromatography.

This one-step purification procedure produces protein of very high purity suitable for crystallization trials and functional studies .

How can researchers accurately measure MdlB enzymatic activity and substrate specificity?

To accurately measure MdlB enzymatic activity and substrate specificity, researchers should employ multiple complementary approaches:

ATP hydrolysis assay:

  • Purify MdlB protein to homogeneity using affinity chromatography.

  • Measure ATP hydrolysis using a coupled enzymatic assay or radioactive ATP.

  • Test ATP hydrolysis in the presence of various potential substrates to identify those that stimulate ATPase activity.

  • Calculate kinetic parameters (Km, Vmax) for different substrates.

Transport assays:

  • Reconstitute purified MdlB into proteoliposomes.

  • Load liposomes with fluorescent substrates.

  • Initiate transport by adding ATP and measure substrate efflux over time.

  • Compare transport rates for different substrates to establish specificity profiles.

Binding assays:

  • Use isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to measure direct binding of substrates to purified MdlB.

  • Determine binding affinities (Kd values) for various compounds.

For menadione reductase activity specifically, which has been associated with MdlB function, researchers should measure the reduction of menadione in the presence of either NADH or NADPH, as previous studies have reported both FMN/NADH and FAD/NADPH dependence .

What statistical approaches are recommended for analyzing MdlB-related experimental data?

When analyzing experimental data related to MdlB, appropriate statistical methods are crucial for robust interpretations:

For enzymatic activity measurements:

  • Calculate mean, standard deviation, and coefficient of variation for replicate measurements.

  • Use the Student's t-test or ANOVA for comparing activity across different conditions.

  • Apply non-linear regression to determine enzyme kinetics parameters.

For minimum inhibitory concentration (MIC) studies:

  • Determine the MIC using microdilution methods following international standards (e.g., ISO) .

  • Present data as geometric means with 95% confidence intervals.

  • Use appropriate statistical tests to compare MICs between wild-type and mutant strains.

For gene expression analyses:

  • Normalize expression data using validated reference genes.

  • Apply parametric or non-parametric tests based on data distribution.

For method detection limit (MDL) calculations:
When developing assays to detect MdlB activity, the MDL can be calculated using the following formula :

MDLs=t(n1,1α=0.99)×SsMDL_s = t_{(n-1, 1-\alpha=0.99)} \times S_s

Where:

  • MDLs = the method detection limit based on spiked samples

  • t(n-1, 1-α = 0.99) = the Student's t-value for a single-tailed 99th percentile t statistic with n-1 degrees of freedom

  • Ss = sample standard deviation of the replicate analyses

A reference table for t-values at different degrees of freedom should be consulted :

Number of replicatesDegrees of freedom (n-1)t (n-1, 0.99)
763.143
872.998
982.896
1092.821
11102.764

How does MdlB research contribute to our understanding of broader antimicrobial resistance mechanisms?

Research on MdlB provides critical insights into fundamental mechanisms of antimicrobial resistance:

  • Evolutionary perspective: Studies have mapped the evolutionary timeline of MdlB and similar resistance factors, revealing that these mechanisms evolved much earlier than previously thought. This highlights the intrinsic nature of resistance mechanisms rather than simply being a response to human antibiotic use .

  • Structural insights: Understanding the structural basis of MdlB function illuminates common mechanisms across the ABC transporter family, which are responsible for multidrug resistance in various pathogens and cancer cells .

  • Resistance network understanding: MdlB research helps elucidate how multiple transporters work together to create robust resistance networks in bacteria, informing broader strategies to combat antimicrobial resistance.

  • Novel therapeutic approaches: Identifying the molecular mechanisms of MdlB function opens new avenues for developing inhibitors that could restore antibiotic sensitivity. For example, research on similar proteins has shown that targeting the nucleotide-binding domains of transporters can effectively inhibit their function .

What are the current challenges in designing effective research questions for MdlB studies?

Designing effective research questions for MdlB studies faces several challenges:

  • Specificity limitations: Questions must be narrowly focused while still contributing to the broader understanding of multidrug resistance. As noted in research methodology literature, "you can actually do your best work when you have a concise and focused question" .

  • Technical constraints: Research questions must consider the technical feasibility of isolating MdlB effects from those of other transporters in the bacterial cell.

  • Translational relevance: Balancing basic mechanistic questions with those that have clear translational potential for addressing antimicrobial resistance.

  • Appropriate controls: Formulating questions that allow for proper control experiments to distinguish MdlB-specific effects from general cellular responses.

The most effective research questions for MdlB studies follow these principles:

  • Focus on specific aspects of MdlB function rather than broad effects

  • Include clear comparative elements (e.g., MdlB vs. other transporters)

  • Address contradictions in existing literature (e.g., FMN/NADH vs. FAD/NADPH dependence)

  • Consider evolutionary context and structural-functional relationships

How can researchers integrate findings from MdlB studies with the broader context of bacterial physiology?

Integrating MdlB findings with broader bacterial physiology requires:

  • Systems biology approaches: Combine MdlB-specific data with global analyses of bacterial transcriptomes, proteomes, and metabolomes under various stress conditions.

  • Network analysis: Map interactions between MdlB and other cellular components to understand its role within broader cellular networks.

  • Comparative genomics: Analyze the presence, absence, and variation of MdlB across bacterial species in relation to their ecological niches and resistance profiles.

  • Physiological context: Study MdlB expression and function under various physiological conditions, including:

    • Nutrient limitation

    • Oxidative stress

    • Biofilm formation

    • Host-pathogen interactions

  • Functional redundancy analysis: Determine how loss of MdlB function affects expression and activity of other transporters and resistance mechanisms.

A comprehensive research program might start with specific MdlB-focused studies and gradually expand to include these integrative approaches, using findings from one level to inform hypotheses at other levels of biological organization.

What emerging technologies show promise for advancing MdlB research?

Several emerging technologies offer significant potential for advancing MdlB research:

  • Cryo-electron microscopy (Cryo-EM): This technique allows visualization of MdlB in different conformational states during the transport cycle, providing insights impossible to obtain with crystallography alone.

  • CRISPR-Cas9 genome editing: Precise modification of the mdlB gene in its native context enables detailed structure-function studies and investigation of its regulatory networks .

  • Single-molecule techniques: Methods like single-molecule FRET can track conformational changes in MdlB during substrate binding and transport in real-time.

  • Nanodiscs and other membrane mimetics: These systems provide more native-like environments for studying MdlB function compared to detergent-solubilized preparations.

  • Computational approaches: Advanced molecular dynamics simulations combined with machine learning can predict substrate specificity and identify potential inhibitor binding sites, similar to approaches used for studying other MDR proteins .

These technologies will enable researchers to address longstanding questions about the mechanistic details of MdlB function and its role in multidrug resistance.

How might research on bacterial MdlB inform therapeutic strategies against multidrug resistant pathogens?

Research on bacterial MdlB has several potential applications for developing therapeutic strategies against multidrug-resistant pathogens:

  • Novel inhibitor development: Structural and functional studies of MdlB can guide the design of specific inhibitors targeting its ATP-binding and hydrolysis mechanisms. This approach has shown promise in recent studies where compounds were identified that interact with conserved residues in the nucleotide-binding domains of similar transporters .

  • Bacteriophage-derived enzymes: Research has demonstrated that enzymes from bacteriophages can target bacterial outer capsules, making bacteria more vulnerable to immune system clearance . Similar approaches might be developed to target MdlB function.

  • Combination therapies: Understanding the specific substrates of MdlB can inform rational design of drug combinations that overcome efflux-mediated resistance.

  • Evolutionary insights: Mapping the evolution of MdlB and related transporters helps predict how resistance might develop to new antibiotics, enabling proactive development of countermeasures.

  • Diagnostic applications: Knowledge of MdlB structure and function could lead to rapid diagnostic tests that identify specific resistance mechanisms in clinical isolates, enabling more targeted treatment approaches.

What are the potential interdisciplinary connections between MdlB research and other scientific fields?

MdlB research connects with multiple scientific disciplines, offering rich opportunities for collaboration:

  • Cancer research: MdlB is functionally similar to mammalian multidrug resistance proteins implicated in cancer therapy resistance. Insights from bacterial systems can inform understanding of eukaryotic ABC transporters like P-glycoprotein and MRP1 .

  • Structural biology: Advanced techniques developed for studying membrane protein structure and dynamics have broad applications beyond MdlB research.

  • Synthetic biology: Engineering MdlB variants with modified substrate specificities could create bacterial chassis for bioremediation or biosynthesis of valuable compounds.

  • Evolutionary biology: Studying MdlB evolution provides insights into how core cellular machinery adapts to environmental challenges over evolutionary time.

  • Computational sciences: Algorithm development for predicting protein-substrate interactions based on MdlB studies has applications across protein science and drug discovery.

  • Immunology: Understanding how bacterial efflux systems like MdlB affect the presentation of bacterial antigens to the immune system could inform vaccine development strategies.

Cultivating these interdisciplinary connections can accelerate progress in MdlB research while also contributing valuable insights to adjacent fields.

What are common challenges in purifying active MdlB protein and how can they be addressed?

Researchers frequently encounter several challenges when purifying active MdlB protein:

  • Low expression levels:

    • Challenge: MdlB is a membrane protein and may exhibit low expression levels in recombinant systems.

    • Solution: Optimize codon usage for the expression host, use strong inducible promoters, and consider fusion tags that enhance expression and solubility.

  • Protein aggregation:

    • Challenge: Membrane proteins like MdlB tend to aggregate during extraction and purification.

    • Solution: Screen multiple detergents for extraction efficiency; consider using mild detergents like DDM or LMNG; maintain low temperature during all purification steps.

  • Loss of activity:

    • Challenge: MdlB may lose its native conformation and activity during purification.

    • Solution: Add stabilizing agents such as glycerol (6-50%) to buffer solutions ; include appropriate cofactors (flavins) in purification buffers based on previous findings that MdlB co-purifies with flavin .

  • Cofactor uncertainty:

    • Challenge: Confusion remains regarding whether MdlB utilizes FMN or FAD as a cofactor .

    • Solution: Perform spectroscopic analysis of purified protein; test activity with both cofactors; consider purifying the protein without removing the natural cofactor.

A refined purification protocol based on successful approaches includes:

  • Express MdlB with an N-terminal His tag in E. coli BL21(DE3)

  • Extract membrane proteins with a suitable detergent buffer

  • Purify using nickel-affinity chromatography

  • Consider a second purification step (e.g., size exclusion chromatography) if higher purity is required

  • Store in Tris/PBS-based buffer with 6-50% trehalose at pH 8.0

  • Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles

How can researchers validate that their recombinant MdlB protein retains native functionality?

Validating native functionality of recombinant MdlB requires multiple complementary approaches:

  • ATPase activity assay:

    • Measure ATP hydrolysis rates using colorimetric assays (e.g., malachite green) or radiometric methods.

    • Compare activity to published values and verify appropriate kinetic parameters.

    • Ensure activity is inhibited by known ABC transporter inhibitors.

  • Substrate transport assays:

    • Reconstitute purified MdlB in proteoliposomes.

    • Verify ATP-dependent transport of known substrates (e.g., menadione).

    • Confirm that transport is abolished by ATPase inhibitors or ATP-binding site mutations.

  • Binding studies:

    • Verify cofactor binding (FMN or FAD) using spectroscopic methods.

    • Measure substrate binding using techniques like isothermal titration calorimetry.

  • Functional complementation:

    • Express recombinant MdlB in an mdlB-knockout strain.

    • Verify restoration of drug resistance phenotypes.

    • Compare growth characteristics in the presence of known MdlB substrates.

  • Structural integrity:

    • Perform circular dichroism spectroscopy to confirm proper secondary structure.

    • Use limited proteolysis to verify correct folding.

    • Employ thermal shift assays to assess protein stability.

What controls should be included in experiments evaluating MdlB's role in multidrug resistance?

Proper experimental design for studying MdlB's role in multidrug resistance requires rigorous controls:

  • Genetic controls:

    • Wild-type strain (positive control)

    • mdlB knockout strain (negative control)

    • Complemented knockout strain expressing wild-type MdlB (restoration control)

    • Strains expressing MdlB with mutations in critical residues (specificity control)

  • Biochemical controls:

    • ATP vs. non-hydrolyzable ATP analogs (to verify ATP dependence)

    • Various divalent cations (Mg²⁺, Mn²⁺, Ca²⁺) to determine cation requirements

    • Inhibitors targeting different domains of ABC transporters

    • Competitors that are known substrates of different efflux pumps

  • Experimental design controls:

    • Dose-response curves rather than single concentrations of drugs

    • Time-course experiments to capture dynamic responses

    • Multiple independent biological replicates (n ≥ 3)

    • Technical replicates within each biological replicate

  • Analytical controls:

    • Standard curves for all quantitative measurements

    • Method detection limit (MDL) calculations using the formula:
      MDLs = t(n-1, 1-α=0.99) × Ss

    • Include both positive and negative results in analysis, not just "detected" vs. "not detected"

A comprehensive experimental design for studying MdlB's role in multidrug resistance would incorporate these controls while systematically evaluating responses to multiple classes of antibiotics or toxic compounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.