Recombinant Escherichia coli Multidrug transporter emrE (emrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
emrE; eb; mvrC; b0543; JW0531; Multidrug transporter EmrE; Efflux-multidrug resistance protein EmrE; Ethidium resistance protein; Methyl viologen resistance protein C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
emrE
Target Protein Sequence
MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAY AIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLSRSTPH
Uniprot No.

Target Background

Function
EmrE is a multidrug efflux protein conferring resistance to various toxic compounds, including ethidium, methyl viologen, acriflavine, tetraphenylphosphonium (TPP+), benzalkonium, propidium, dequalinium, and the aminoglycoside antibiotics streptomycin and tobramycin. It also transports osmoprotectants such as betaine and choline. Drug efflux is coupled to proton influx, capable of antiporting a drug with either one or two protons, enabling both electrogenic and electroneutral transport of a single substrate. It simultaneously binds and co-transports protons and the drug substrate.
Gene References Into Functions
  1. Optimal peptide staple positions for inhibiting proton-driven ethidium efflux were identified using free-energy simulations and validated experimentally. This approach offers a general strategy for peptide therapeutic design. PMID: 30082384
  2. EmrE exhibits versatile substrate export capabilities, coupling drug antiport to one or two protons, facilitating both electrogenic and electroneutral single-substrate transport. PMID: 29114048
  3. Analysis using the BLaTM system demonstrates sequence-specific and strong antiparallel interaction of TMD4, the known dimerization domain of EmrE, compared to parallel interaction. PMID: 28432015
  4. This research reveals a mechanism for regulating membrane protein topogenesis via post-translational annealing of initially misintegrated protein configurations to achieve fully integrated multispanning topologies. PMID: 26408961
  5. Studies indicate a substrate binding pattern where GLU14 interacts with positively charged substrate fragments and other aromatic residues within EmrE. PMID: 26014489
  6. EmrE mutants were created to determine the functional significance of specific loop length and composition based on structural findings. PMID: 25406320
  7. Serine substitution for alanine in EmrE homologues conferred robust methyl viologen resistance in vivo and facilitated methyl viologen transport in proteoliposome assays. PMID: 25479374
  8. This study analyzed fused versions of the dual-topology transporter EmrE using blue-native PAGE and in vivo activity measurements. PMID: 24690367
  9. The rate of EmrE interconversion between inward- and outward-facing states varies significantly, indicating substrate identity's role in regulating this crucial transport step. PMID: 24448799
  10. Betaine and choline were identified as natural quaternary cation substrates of EmrE. PMID: 22942246
  11. A single mutation transformed EmrE, a drug/H+ antiporter, into a polyamine importer. PMID: 23035252
  12. EmrE structure in liposomes and associated substrate-induced conformational changes were investigated. PMID: 20551331
  13. A single positively charged residue's placement influences EmrE topology, highlighting the plasticity of membrane protein insertion mechanisms. PMID: 20508091
  14. EmrE is a proton-coupled multi-drug transporter in Escherichia coli. PMID: 15189838
  15. EmrE transports monovalent and divalent substrates with consistent stoichiometry. PMID: 15371426
  16. Ligand binding to EmrE was analyzed using isothermal titration calorimetry. PMID: 15501941
  17. Crystallographic analysis of the integral membrane protein EmrE from Escherichia coli was conducted. PMID: 15583400
  18. A unique carboxyl residue in EmrE was analyzed using mass spectrometry. PMID: 15623511
  19. Tryptophan 63, the sole essential Trp residue in EmrE, acts as a sensor for ligand binding and/or conformational changes following substrate binding. PMID: 15882076
  20. The binding domain of EmrE was analyzed. PMID: 16049002
  21. Topological analysis of the EmrE protein was performed. PMID: 17003034
  22. Electron cryo-microscopy (cryo-EM) revealed a 3D structure of EmrE with quasi-symmetry in parts of the structure. PMID: 17005200
  23. Experimental evidence demonstrated the evolutionary potential of EmrE, a protein composed of two homologous but oppositely oriented domains, occurring through a limited number of steps. PMID: 17255477
  24. While initial EmrE structures were retracted due to software errors, the proposed antiparallel orientation of monomers remains a subject of ongoing discussion. PMID: 17452106
  25. NMR spectral comparisons between wildtype and mutant EmrE (EmrE-E14C) enabled assignment of the chemical shift of E14's carboxylic carbon. PMID: 17976529
  26. Corrected EmrE structures were reported, based on original diffraction data, new data from selenomethionine (SeMet)-labeled crystals, and functional assays. PMID: 18024586
  27. Glu14's asymmetric nature within the EmrE dimer is crucial for substrate transport. PMID: 18042544
  28. In vivo activity assays supporting a parallel EmrE protomer topology within the functional dimer were conducted. PMID: 18059473
  29. A coupled insertion and assembly model for EmrE was proposed, highlighting how favorable parallel dimer interface energetics overcome topological constraints from asymmetric charge distribution. PMID: 18616286
  30. Substrate-bound X-ray structures support the antiparallel monomer orientation, representing a novel structural paradigm for membrane proteins. PMID: 19171974
  31. Findings suggest that increased lateral phospholipid chain pressure hinders EmrE insertion across the bilayer. PMID: 19699749
Database Links
Protein Families
Small multidrug resistance (SMR) protein family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is EmrE and what is its physiological role?

EmrE is a small multidrug resistance (SMR) transporter from Escherichia coli consisting of 110 amino acid residues. It functions primarily as a proton-coupled antiporter that extrudes positively charged aromatic drugs in exchange for two protons, thereby conferring resistance to a variety of toxic compounds . EmrE belongs to the "Qac" (quaternary ammonium compound) subtype of the SMR family, which are characterized by their ability to export quaternary ammoniums and other hydrophobic, cationic compounds . This efflux mechanism represents a fundamental bacterial defense strategy against antibiotics and antiseptics, making EmrE an important contributor to multidrug resistance in bacteria.

How does the structure of EmrE relate to its function?

EmrE functions as a homodimeric transporter with an antiparallel asymmetric topology. Recent structural analyses at 2.9 Å resolution revealed that the protein's drug-binding site is dominated by aromatic residues such as W63 and Y60, which adopt different rotamers to accommodate structurally diverse substrates . The binding site features a relatively sparse hydrogen bond network among its residues, allowing for increased sidechain flexibility that contributes to EmrE's broad substrate specificity . The E14 residue plays a critical role in proton binding, with the substrate positioned asymmetrically closer to E14 in subunit A than in subunit B, explaining the asymmetric protonation pattern observed in the protein . This structural arrangement facilitates the alternating access mechanism essential for substrate transport across the membrane.

What types of substrates does EmrE transport?

EmrE displays remarkable substrate promiscuity, transporting a diverse range of compounds that share the common feature of being positively charged. Its substrate repertoire includes:

Substrate ClassExamplesStructural Features
Quaternary ammoniumsBenzalkonium, cetyltrimethylammoniumPositively charged nitrogen with four substituents
Quaternary phosphoniumsTetra(4-fluorophenyl) phosphonium (F₄-TPP⁺)Positively charged phosphorus with four substituents
Planar polyaromatic compoundsVarious aromatic antibioticsConjugated aromatic ring systems
Substituted guanidiniumsVarious guanidinium derivativesGuanidine core with substitutions

This broad substrate specificity makes EmrE particularly effective in conferring resistance to multiple classes of antimicrobial compounds, including common household antiseptics and clinical antibiotics . The molecular basis for this promiscuous binding appears to involve the conformational flexibility of key aromatic residues in the binding pocket and the spacious nature of the binding site that allows substrates to reorient at physiological temperatures .

What techniques have been most effective for determining EmrE structure?

The structural elucidation of EmrE has been challenging due to its membrane protein nature. Recent breakthroughs have employed multiple complementary techniques:

  • Solid-state NMR Spectroscopy: Using ¹⁹F and ¹H solid-state NMR with fluorinated substrates (such as F₄-TPP⁺) in phospholipid bilayers has provided critical constraints through protein-substrate distances (214 measurements in recent studies) . This approach has the advantage of maintaining the protein in a native-like membrane environment.

  • Multipurpose Crystallization Chaperones: A novel approach that has yielded high-resolution crystal structures of EmrE at 2.9 Å, both in apo form and in complex with diverse substrates . This technique has overcome previous limitations that resulted in unreliable structural models with poor helical geometry.

  • Computational Modeling Constrained by Experimental Data: Models informed by low-resolution data have helped bridge gaps in structural knowledge, particularly before high-resolution structures became available .

For researchers pursuing structural studies of EmrE, combining these methods offers the most comprehensive approach, with solid-state NMR providing dynamic information that complements the static snapshots from crystallography .

How can researchers effectively express and purify functional EmrE for structural and biochemical studies?

Successful expression and purification of functional EmrE requires careful consideration of several factors:

  • Expression Systems: E. coli, yeast, baculovirus, or mammalian cell expression systems can be employed, with E. coli often preferred for its simplicity and high yield . For structural studies, bacterial expression in minimal media with selective isotopic labeling has proven valuable for NMR investigations.

  • Detergent Solubilization: EmrE retains its function when solubilized in appropriate detergents, making it amenable to biochemical and biophysical studies . Detergent screening is critical, with dodecylmaltoside (DDM) and n-decyl-β-D-maltopyranoside (DM) commonly used for initial extraction.

  • Reconstitution into Lipid Environments: For functional studies, reconstitution into proteoliposomes or nanodiscs provides a more native-like environment. Phospholipid composition significantly affects EmrE activity and should be optimized.

  • Quality Control: Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can verify the dimeric state of purified EmrE, while substrate binding assays confirm functional integrity.

Researchers should note that EmrE's stability and function are highly dependent on pH and lipid environment, factors that must be carefully controlled throughout the purification process to maintain the protein in an active state .

How does EmrE contribute to the broader phenomenon of bacterial multidrug resistance?

EmrE belongs to a network of multidrug transporters that collectively contribute to bacterial resistance through several mechanisms:

  • Direct Efflux of Antimicrobials: EmrE directly exports various antibiotics and antiseptics, reducing their intracellular concentration below effective levels .

  • Contribution to the "Resistosome": Evidence suggests that multidrug transporters interact functionally, forming what has been termed a cellular "Resistosome" . This network approach to resistance involves coordinated expression and activity of multiple transporters with overlapping substrate specificities.

  • Evolutionary Adaptation: The promiscuous nature of EmrE allows bacteria to rapidly adapt to new antimicrobial challenges, as the transporter can often accommodate novel compounds with similar physicochemical properties to known substrates .

  • Plasmid-Mediated Resistance Transfer: The genes encoding SMR proteins like EmrE are often found on mobile genetic elements, facilitating horizontal gene transfer and spreading resistance among bacterial populations .

This multifaceted contribution to resistance makes EmrE and related transporters important targets for strategies aimed at combating antimicrobial resistance. Understanding how EmrE interacts with other resistance mechanisms can inform more effective approaches to antibiotic development and stewardship .

What methods are most effective for studying EmrE's substrate specificity in the context of antibiotic resistance?

Investigating EmrE's substrate specificity requires a combination of approaches:

  • Minimum Inhibitory Concentration (MIC) Assays: Comparing the antibiotic susceptibility of wild-type bacteria with EmrE knockout strains and EmrE-overexpressing strains provides functional evidence of EmrE's role in resistance to specific compounds.

  • Direct Transport Assays: Measuring the transport of radiolabeled or fluorescent substrates in proteoliposomes containing purified EmrE provides quantitative data on transport kinetics and substrate preferences.

  • Binding Affinity Measurements: Isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) can determine binding affinities for various substrates, helping to establish structure-activity relationships.

  • Structure-Guided Mutagenesis: Based on the recently solved structures, targeted mutations of binding site residues (particularly W63, Y60, and E14) can probe the molecular determinants of substrate recognition .

  • Computational Docking and MD Simulations: These approaches can predict binding modes and affinities for novel compounds, guiding experimental design.

By integrating these methods, researchers can develop a comprehensive understanding of EmrE's substrate profile and potentially design inhibitors that could restore antibiotic efficacy by blocking efflux .

How does EmrE accommodate structurally diverse substrates in its binding pocket?

EmrE's remarkable substrate promiscuity stems from several structural features:

  • Flexible Aromatic Residues: Key binding site residues, particularly W63 and Y60, adopt different rotameric conformations to conform to disparate substrate structures without requiring major rearrangements of the protein backbone . This "induced fit" mechanism allows accommodation of substrates with varying shapes and sizes.

  • Sparse Hydrogen Bond Network: Unlike more selective transporters like Gdx-Clo (which transports a narrow substrate range), EmrE has a relatively sparse hydrogen bond network among binding site residues, permitting increased sidechain flexibility . This arrangement allows binding site residues to adjust their positions to optimize interactions with different substrates.

  • Spacious Binding Pocket: The binding site is sufficiently spacious to allow tetrahedral substrates like F₄-TPP⁺ to reorient at physiological temperatures, as revealed by solid-state NMR studies .

  • Aromatic-Cation Interactions: The predominance of aromatic residues in the binding pocket facilitates interactions with the cationic portions of substrates through π-cation interactions, providing a common recognition mechanism for diverse cationic compounds.

These structural features collectively enable EmrE to bind and transport a wide range of compounds with the common feature of positive charge, making it an efficient multidrug resistance transporter .

What is currently understood about the proton-coupled transport mechanism of EmrE?

The proton-coupling mechanism of EmrE involves several key elements:

  • Protonation States of E14: The glutamate at position 14 in both subunits serves as the primary proton-binding site. In the drug-bound state, at least one E14 is deprotonated to interact with the positively charged substrate .

  • Asymmetric Substrate Positioning: Recent structural data revealed that substrates like F₄-TPP⁺ lie closer to E14 in subunit A than in subunit B, explaining the asymmetric protonation of the protein during the transport cycle .

  • Conformational Switching: The transport cycle involves alternating access, where the binding site switches orientation between the cytoplasmic and periplasmic sides of the membrane. This conformational change is coupled to proton binding and release.

  • Stoichiometry: EmrE exchanges one substrate molecule for two protons, using the proton gradient as the driving force for active efflux of substrates .

  • pH Dependence: Transport activity is highly pH-dependent, reflecting the critical role of protonation/deprotonation events in the transport cycle.

Understanding this mechanism is crucial for designing potential inhibitors that could block the conformational changes necessary for transport or interfere with proton coupling .

How does EmrE differ from other SMR family transporters in terms of structure and function?

The SMR family contains two major physiological subtypes with distinct characteristics:

FeatureEmrE (Qac Subtype)Gdx-Clo (Gdx Subtype)
Substrate SpecificityBroad: quaternary ammoniums, phosphoniums, polyaromatic compoundsNarrow: primarily guanidinium ion (Gdm⁺) and derivatives
Binding Site FlexibilitySparse hydrogen bond network allowing flexible sidechainsMore rigid binding site with specific interactions
Evolutionary RoleAssociated with resistance to antiseptics and antibioticsFocused on export of the bacterial metabolite guanidinium
Binding Site PortalAccommodates diverse substratesOpens a specific portal for guanidinium compounds with long alkyl tails

Comparative structural analysis between EmrE and Gdx-Clo has revealed that the more selective substrate profile of Gdx-Clo correlates with a more rigid binding site structure, while EmrE's promiscuity stems from greater conformational flexibility . This comparison provides insights into how subtle differences in binding site architecture can dramatically impact substrate selectivity in the SMR family.

What are the key experimental challenges in studying EmrE and how can they be overcome?

Researchers face several challenges when studying EmrE:

  • Membrane Protein Expression and Stability: As a membrane protein, EmrE presents challenges in expression and purification. This can be addressed through optimization of expression systems, detergent selection, and stabilizing mutations like S64V that reduce conformational dynamics without abolishing function .

  • Conformational Heterogeneity: EmrE's inherent conformational flexibility, while functionally important, complicates structural studies. Approaches to address this include:

    • Using substrate analogs that lock the protein in specific conformations

    • Employing techniques like solid-state NMR that can capture dynamic information

    • Utilizing novel crystallization chaperones as demonstrated in recent structural studies

  • Antiparallel Topology: EmrE's unusual antiparallel topology has been controversial in the field. Definitive evidence can be obtained through techniques like asymmetric labeling combined with EPR or fluorescence studies.

  • Functional Reconstitution: Activity assays require reconstitution into membrane systems with proper orientation. Using techniques like site-directed fluorescence labeling can help verify orientation and functional state.

  • Distinguishing Direct vs. Indirect Effects in Resistance Studies: When studying EmrE's contribution to resistance in vivo, distinguishing its direct effects from interactions with other resistance mechanisms requires careful genetic controls and complementary biochemical approaches.

Addressing these challenges requires integrating multiple techniques and careful experimental design to ensure robust and reliable results .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.