Recombinant Escherichia coli N-acetylgalactosamine permease IIC component 1 (agaC)

Shipped with Ice Packs
In Stock

Description

Genetic Context and Regulation

The agaC gene is part of a larger gene cluster involved in N-acetylgalactosamine metabolism in E. coli. This gene, along with other aga genes, is transcriptionally regulated by the AgaR repressor from the DeoR family of transcriptional factors . The AgaR protein recognizes specific sequences with the consensus WRMMTTTCRTTTYRTTTYNYTTKK (where W is A or T, Y is C or T, R is A or G, M is A or C, and K is G or T) located in the promoter regions of the agaZ, agaS, and agaR genes .

Research has shown that all three promoters exhibited elevated activity in the presence of N-acetylgalactosamine or galactosamine in the medium, and this induction was dependent on the AgaR repressor . Though the exact effector for AgaR has not been definitively identified, it has been proposed that phosphorylated intermediates of the N-acetylgalactosamine/galactosamine catabolic pathway, particularly N-acetylgalactosamine-6-phosphate and/or galactosamine-6-phosphate, may serve as molecular inducers .

Functional Role in Bacterial Sugar Metabolism

The agaC protein plays a crucial role in the N-acetylgalactosamine utilization pathway, which allows bacteria to use N-acetylgalactosamine and galactosamine as carbon and nitrogen sources . This pathway is particularly important for bacterial adaptation to different nutrient environments and represents a significant aspect of bacterial carbohydrate metabolism.

Transport Function and Pathway Integration

The complete N-acetylgalactosamine/galactosamine utilization pathway in E. coli involves:

  1. Transport and phosphorylation of N-acetylgalactosamine/galactosamine substrates

  2. Deacetylation of N-acetylgalactosamine-6-phosphate

  3. Deamination/isomerization of galactosamine-6-phosphate

  4. Phosphorylation of tagatose-6-phosphate

  5. Cleavage of tagatose-1,6-bisphosphate to produce glyceraldehyde 3-phosphate and glycerone phosphate

Two PTS systems encoded by agaBCD and agaVWEF genes have been confirmed to mediate transport and phosphorylation of galactosamine and N-acetylgalactosamine, respectively . The agaC protein, as part of the agaBCD system, is specifically involved in galactosamine transport.

Strain Differences and Essentiality

Studies on gene knockouts have shown that agaC is not essential for growth under standard laboratory conditions. Essentiality data for agaC knockouts demonstrate viability across various growth media as summarized in the following table:

Growth MediumGrowth Observed?Temperature (°C)Oxygen ConditionpHOther Observations
LB enrichedYes37Aerobic6.95Viable growth
LB LennoxYes37Aerobic7Viable growth
M9 medium with 1% glycerolYes37Aerobic7.2Viable growth
MOPS medium with 0.4% glucoseYes37AerobicNot specifiedViable growth

This non-essentiality suggests redundancy in sugar transport systems or metabolic flexibility in E. coli under common laboratory growth conditions.

Recombinant Production and Characterization

Recombinant agaC protein has been successfully expressed and purified for research purposes. The recombinant form typically consists of the full-length E. coli N-acetylgalactosamine permease IIC component 1 (agaC) protein (P42910) spanning amino acids 1-267, fused to an N-terminal histidine tag, and expressed in E. coli expression systems .

Production and Purification

The recombinant protein is typically produced as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE . The production process leverages E. coli expression systems, taking advantage of the organism's rapid growth and well-established protein expression protocols.

Physical and Chemical Properties

The recombinant agaC protein exhibits the following characteristics:

PropertySpecification
SpeciesE. coli
Expression SystemE. coli
TagHistidine
Protein LengthFull Length (1-267 amino acids)
FormLyophilized powder
Purity>90% (SDS-PAGE)
ApplicationsSDS-PAGE
Storage Recommendations-20°C/-80°C, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage

Research Applications and Significance

The study of recombinant agaC protein contributes significantly to our understanding of bacterial sugar metabolism, particularly the N-acetylgalactosamine utilization pathway in Proteobacteria. This research area has broader implications for bacterial physiology, adaptation, and potential biotechnological applications.

Contribution to Understanding Bacterial Metabolism

Research on agaC and other components of the N-acetylgalactosamine utilization pathway has revealed the diversity of amino sugar utilization pathways among different bacteria . Genomic reconstruction of N-acetylgalactosamine utilization pathways and AgaR transcriptional regulons in the genomes of Proteobacteria has identified multiple novel genes with specific functional roles .

Most variations in the pathway across different bacterial species have been attributed to amino sugar transport, phosphorylation, and deacetylation steps, while the downstream catabolic enzymes in the pathway were largely conserved . This suggests that the transport components, including agaC, represent adaptable elements in the evolution of sugar utilization pathways.

Methodological Applications

The recombinant agaC protein, particularly with its histidine tag, serves as a valuable tool for various biochemical and structural studies. The protein can be used in applications such as:

  1. In vitro reconstitution of transport systems

  2. Enzyme assays to study transport kinetics

  3. Structural biology investigations

  4. Antibody production for immunological studies

  5. Protein-protein interaction studies to identify binding partners in the transport system

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend contacting your local distributors for specific delivery timeframes.
As a standard practice, all our proteins are shipped with blue ice packs. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
agaC; yraE; b3139; JW3108; N-acetylgalactosamine permease IIC component 1; EIIC-Aga; PTS system N-acetylgalactosamine-specific EIIC component 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
agaC
Target Protein Sequence
MHEITLLQGLSLAALVFVLGIDFWLEALFLFRPIIVCTLTGAILGDIQTGLITGGLTELA FAGLTPAGGVQPPNPIMAGLMTTVIAWSTGVDAKTAIGLGLPFSLLMQYVILFFYSAFSL FMTKADKCAKEADTAAFSRLNWTTMLIVASAYAVIAFLCTYLAQGAMQALVKAMPAWLTH GFEVAGGILPAVGFGLLLRVMFKAQYIPYLIAGFLFVCYIQVSNLLPVAVLGAGFAVYEF FNAKSRQQAQPQPVASKNEEEDYSNGI
Uniprot No.

Target Background

Function
The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) serves as a primary carbohydrate active transport system. It facilitates the phosphorylation of incoming sugar substrates concurrently with their translocation across the cell membrane. This system plays a crucial role in N-acetylgalactosamine transport.
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of agaC in Escherichia coli?

The agaC gene encodes the IIC component of a phosphotransferase system (PTS) involved in the transport and phosphorylation of N-acetylgalactosamine (GalNAc) and galactosamine (GalN) in Escherichia coli. As part of the agaBCD operon, agaC specifically functions as a membrane component that facilitates the recognition and translocation of these amino sugars across the cell membrane . The PTS system encoded by agaBCD has been experimentally confirmed to mediate the transport and phosphorylation of galactosamine, working in concert with other components to initiate the catabolic pathway that enables E. coli to utilize these substrates as carbon and nitrogen sources .

How does the agaC component interact with other proteins in the GalNAc utilization pathway?

The agaC component operates within a multi-protein complex that forms a complete phosphotransferase system. Research has demonstrated that agaC functions as part of the agaBCD operon, which encodes a specific PTS for galactosamine transport . This system works in coordination with:

  • The agaB component (IIB domain) - involved in phosphoryl transfer

  • The agaD component (IID domain) - another membrane component of the transporter

  • General PTS proteins that transfer phosphate from phosphoenolpyruvate to the substrate

The substrate specificity of this system is determined by the combined interaction of these components, with agaC playing a critical role in substrate recognition . After transport and phosphorylation, the resulting GalNAc-6-phosphate enters the catabolic pathway involving deacetylation (by AgaA), deamination/isomerization (by AgaS), and further metabolism through the tagatose 1,6-bisphosphate pathway .

What experimental approaches are recommended for initial characterization of recombinant agaC?

For initial characterization of recombinant agaC, researchers should consider a methodical approach that includes:

  • Expression analysis: Western blotting with specific antibodies to confirm expression levels and protein size

  • Membrane localization studies: Cell fractionation followed by Western blot analysis to confirm proper membrane insertion

  • Functional complementation assays: Testing the ability of recombinant agaC to restore GalNAc/GalN utilization in agaC knockout strains

  • Transport assays: Using radiolabeled substrates to measure uptake rates

  • Structural predictions: Computational analysis of transmembrane domains and potential substrate binding regions

When designing these experiments, it's essential to consider appropriate controls, such as the E. coli ATCC 8739 strain, which has been used in previous studies for gene knockout and complementation analysis .

What methodologies are most effective for studying agaC membrane insertion and topology?

Studying membrane protein topology requires specialized techniques that can provide structural insights while maintaining the native environment of the protein. For agaC research, the following methodologies have proven most effective:

These methodologies should be used in combination to build a comprehensive topological model of agaC in the membrane.

How can contradictory data on agaC transport function be resolved experimentally?

Resolving contradictory data on agaC transport function requires a systematic approach that addresses potential sources of variability across studies:

  • Standardize experimental conditions:

    • Use defined genetic backgrounds (ideally isogenic strains)

    • Maintain consistent growth conditions (medium composition, temperature, aeration)

    • Standardize protein expression levels using controlled induction systems

  • Implement direct comparative analysis:

    • Design side-by-side experiments testing conflicting hypotheses

    • Include appropriate positive and negative controls

    • Use multiple complementary assays to measure transport function

  • Employ precise gene manipulation techniques:

    • Create clean gene deletions using Lambda Red recombination systems as demonstrated in previous studies with E. coli ATCC 8739

    • Complement with cloned genes under controlled expression

    • Verify genotypes by PCR and sequencing to ensure no unintended mutations

  • Analyze potential redundancy in transport systems:

    • Test for functional compensation by alternative transporters (e.g., agaVWEF, which has been shown to transport GalNAc )

    • Create multiple knockout strains to eliminate redundant systems

    • Measure substrate specificity profiles of individual and combined systems

By systematically addressing these factors, researchers can identify the source of contradictions and develop a unified model of agaC transport function.

What expression systems provide optimal yields of functional recombinant agaC?

Optimizing expression of membrane proteins like agaC requires careful consideration of expression systems and conditions:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli BL21(DE3)Native environment, rapid growth, simple inductionPotential toxicity, inclusion body formationLower induction temperature (16-20°C), use of weak promoters (pBAD), addition of membrane-stabilizing agents
E. coli C41/C43Designed for toxic membrane proteins, reduced proteolysisLower expression yields than BL21Optimize induction timing, supplement with rare tRNAs for codon optimization
Cell-free expressionAvoids toxicity issues, allows immediate purificationHigher cost, lower scalabilityAdd lipids or nanodiscs to stabilize membrane proteins, optimize redox conditions
Yeast (P. pastoris)Post-translational modifications, proper foldingLonger development timeUse inducible promoters (AOX1), optimize methanol feeding strategy

For agaC specifically, expression in E. coli systems under the control of the lac promoter has been successfully used in complementation studies . When designing expression constructs, consider:

  • Including a removable purification tag (His6 or FLAG) to facilitate detection and purification

  • Maintaining the native signal sequence to ensure proper membrane targeting

  • Optimizing codon usage for the expression host

  • Including stabilizing partners or fusion proteins to enhance membrane insertion

What computational approaches best predict substrate specificity differences between agaC homologs?

Computational prediction of substrate specificity in agaC homologs requires integrated approaches that combine evolutionary information with structural insights:

  • Multiple sequence alignment and conservation analysis:

    • Align agaC sequences across diverse bacterial species

    • Identify conserved residues that likely participate in core functions

    • Detect variable regions that may determine substrate specificity differences

  • Homology modeling and substrate docking:

    • Generate structural models based on related crystallized transporters

    • Perform in silico docking of various substrates (GalNAc, GalN, and related molecules)

    • Calculate binding energies and identify key interaction residues

  • Evolutionary coupling analysis:

    • Identify co-evolving residue pairs that may form functional networks

    • Map these networks to structural models to predict allosteric pathways

    • Identify specificity-determining positions that vary between homologs with different substrate preferences

  • Machine learning approaches:

    • Train models on known specificity data from characterized transporters

    • Apply models to predict specificity of uncharacterized homologs

    • Validate predictions experimentally through targeted mutagenesis

These computational approaches should be followed by experimental validation through site-directed mutagenesis of predicted specificity-determining residues and subsequent transport assays with different substrates.

How should experiments be designed to study the kinetics of agaC-mediated transport?

Designing robust experiments to study agaC-mediated transport kinetics requires careful consideration of multiple factors:

  • Preparation of appropriate membrane vesicles:

    • Generate inside-out vesicles to expose the cytoplasmic domains

    • Ensure membrane integrity through osmotic shock resistance tests

    • Normalize vesicle preparations by protein content and marker enzyme activities

  • Substrate preparation and validation:

    • Use radiolabeled (³H or ¹⁴C) or fluorescently labeled substrates

    • Verify substrate purity by chromatographic methods

    • Establish detection limits and linear response ranges for quantification

  • Experimental setup for kinetic measurements:

    • Perform time-course experiments to establish initial velocity conditions

    • Vary substrate concentration across a wide range (at least 5× below and above expected K<sub>m</sub>)

    • Include competitive and non-competitive inhibitors to characterize transport mechanism

  • Data analysis approaches:

    • Apply appropriate kinetic models (Michaelis-Menten, Hill equation for cooperativity)

    • Use non-linear regression for parameter estimation

    • Perform statistical analysis to determine confidence intervals for kinetic parameters

When designing these experiments, researchers should include appropriate controls such as vesicles from agaC knockout strains to determine background transport rates, and positive controls using well-characterized transport systems.

What experimental strategies can delineate the roles of agaC versus agaV in GalNAc transport?

Both agaC (part of agaBCD) and agaV (part of agaVWEF) have been implicated in GalNAc transport . Delineating their specific roles requires carefully designed experiments:

  • Generate and characterize single and double knockout strains:

    • Create ΔagaC, ΔagaV, and ΔagaC ΔagaV strains using Lambda Red recombination

    • Verify deletions by PCR and sequencing

    • Assess growth phenotypes on minimal media with GalNAc or GalN as sole carbon sources

  • Perform complementation analysis:

    • Express agaC or agaV from plasmids in the knockout strains

    • Use tightly controlled expression systems to prevent artifacts from overexpression

    • Measure restoration of growth and transport function

  • Conduct substrate specificity analysis:

    • Use transport assays with radiolabeled substrates to determine specificity profiles

    • Test various structurally related compounds (GalNAc, GalN, GlcNAc, etc.)

    • Measure competition between substrates to identify preferential transport

  • Perform domain swapping experiments:

    • Create chimeric proteins containing domains from both transporters

    • Test functionality and substrate specificity of chimeras

    • Map domains responsible for specific recognition features

These approaches have been successfully applied in previous studies that confirmed the role of agaBCD in GalN transport and agaVWEF in GalNAc transport , but can be extended to provide more detailed mechanistic insights.

What analytical techniques provide the most accurate measurement of agaC expression levels?

Accurate quantification of membrane protein expression presents unique challenges due to hydrophobicity and potential aggregation. For agaC, consider these analytical approaches:

  • Quantitative Western blotting:

    • Use purified recombinant agaC as a standard curve

    • Apply multiple antibodies targeting different epitopes

    • Implement fluorescence-based detection for wider linear range

    • Include loading controls appropriate for membrane proteins

  • Mass spectrometry-based approaches:

    • Selected Reaction Monitoring (SRM) for targeted quantification

    • Use isotopically labeled peptide standards

    • Focus on peptides from soluble domains for consistent detection

    • Account for extraction efficiency in sample preparation

  • Flow cytometry with fluorescent tags:

    • Create translational fusions with fluorescent proteins

    • Calibrate using fluorescent beads with known molecule equivalents

    • Apply compensation for cell size and background autofluorescence

  • Quantitative PCR for transcript levels:

    • Design primers specific to agaC sequence regions

    • Use multiple reference genes for normalization

    • Account for potential differences in mRNA stability and translation efficiency

Each method has strengths and limitations, and combining multiple approaches provides the most comprehensive assessment of expression levels.

How can researchers effectively analyze the impact of point mutations on agaC function?

Systematic analysis of point mutations in agaC requires a multi-level approach that integrates functional, structural, and computational methods:

  • Design a comprehensive mutation strategy:

    • Create alanine-scanning libraries across the entire protein

    • Target conserved residues identified through sequence alignment

    • Include conservative and non-conservative substitutions at key positions

    • Generate random mutagenesis libraries for unbiased screening

  • Implement high-throughput functional screens:

    • Develop growth-based selection systems on minimal media with GalNAc/GalN

    • Use fluorescent substrates for flow cytometry-based sorting

    • Apply directed evolution approaches to identify compensatory mutations

  • Perform detailed characterization of selected mutants:

    • Measure transport kinetics (K<sub>m</sub> and V<sub>max</sub>)

    • Analyze protein stability and membrane integration

    • Assess structural changes through spectroscopic methods

    • Determine substrate binding affinities through equilibrium dialysis

  • Apply molecular dynamics simulations:

    • Model wild-type and mutant proteins in membrane environments

    • Analyze conformational changes during simulated transport cycles

    • Calculate energy barriers for substrate translocation

    • Identify altered interaction networks in mutant proteins

This comprehensive approach has been successfully applied to other membrane transporters and can be adapted specifically for agaC analysis.

How should researchers interpret inconsistent results in agaC transport assays?

Inconsistent results in membrane transport assays are common due to the complexity of these systems. A systematic troubleshooting approach includes:

  • Evaluate experimental variables:

    • Check membrane vesicle quality (leakiness, right-side-out vs. inside-out orientation)

    • Verify substrate stability under assay conditions

    • Assess energy coupling (ATP, proton gradient, phosphoenolpyruvate availability)

    • Control temperature fluctuations that may affect membrane fluidity

  • Consider biological variables:

    • Confirm strain genotype and absence of suppressor mutations

    • Assess expression levels across experiments (may vary with growth phase)

    • Evaluate membrane composition effects on transporter function

    • Check for interfering transport systems that may be differentially expressed

  • Apply statistical analysis:

    • Perform sufficient biological and technical replicates (minimum n=3)

    • Use appropriate statistical tests for variability assessment

    • Consider Bayesian approaches for data integration across experiments

    • Identify outliers through standardized residual analysis

  • Implement control experiments:

    • Include positive controls with well-characterized transporters

    • Perform parallel assays with knockout strains as negative controls

    • Use multiple methods to measure transport (e.g., radioisotope uptake and growth assays)

By systematically addressing these factors, researchers can identify sources of variability and develop more robust experimental protocols specific to agaC characterization.

What approaches help resolve compatibility issues when expressing recombinant agaC in heterologous systems?

Expression of recombinant membrane proteins like agaC in heterologous systems frequently encounters compatibility issues. Effective resolution strategies include:

  • Optimize codon usage:

    • Analyze codon bias in the target expression system

    • Synthesize codon-optimized gene versions

    • Consider strategic codon de-optimization in difficult regions to modulate translation rate

  • Adjust expression conditions:

    • Test induction at different growth phases

    • Vary inducer concentration to find optimal expression levels

    • Lower growth temperature during induction (16-20°C)

    • Supplement media with membrane components (phospholipids, cholesterol)

  • Modify protein sequence:

    • Remove or substitute problematic regions (highly hydrophobic segments)

    • Create fusion proteins with well-expressed partners

    • Add stabilizing mutations identified through directed evolution

    • Include solubility-enhancing tags (MBP, SUMO)

  • Address toxicity issues:

    • Use tightly controlled inducible promoters

    • Select expression strains with reduced proteolytic activity

    • Co-express chaperones and membrane insertion machinery

    • Consider cell-free expression systems for highly toxic proteins

This systematic approach has successfully resolved expression issues for numerous membrane transporters and should be applicable to agaC studies.

How can recombinant agaC be effectively used in reconstituted systems to study transport mechanisms?

Reconstitution of recombinant agaC into artificial membrane systems provides a controlled environment to study transport mechanisms:

  • Proteoliposome preparation protocols:

    • Extract agaC from membranes using mild detergents (DDM, LMNG)

    • Purify using affinity chromatography with appropriate tags

    • Mix with lipids at optimal protein:lipid ratios (typically 1:100 to 1:1000)

    • Remove detergent using Bio-Beads, dialysis, or cyclodextrin

    • Verify orientation using protease protection assays

  • Functional characterization approaches:

    • Create artificial gradients (pH, electrical, substrate)

    • Use fluorescent probes to monitor gradient dissipation

    • Apply patch-clamp techniques for electrophysiological measurements

    • Develop real-time assays using stopped-flow fluorimetry

  • Component requirements analysis:

    • Test phosphoryl transfer from phosphoenolpyruvate

    • Reconstitute with purified general PTS components (Enzyme I, HPr)

    • Assess requirements for specific lipid compositions

    • Determine minimal system components needed for function

  • Single-molecule studies:

    • Label specific residues with fluorophores for FRET analysis

    • Monitor conformational changes during transport cycle

    • Measure substrate binding events through fluorescence correlation spectroscopy

    • Apply optical tweezers for force measurements during transport

These reconstitution approaches provide mechanistic insights that cannot be obtained in complex cellular systems and allow precise control over all system components.

What experimental design considerations are crucial when using agaC as a model for studying evolutionary adaptation in transport systems?

Using agaC as a model for evolutionary adaptation studies requires careful experimental design:

  • Experimental evolution setup:

    • Design selective conditions that specifically target transporter function

    • Create environments with gradually changing substrate availability

    • Implement replicate populations to distinguish stochastic from deterministic changes

    • Follow the established protocols for long-term evolution experiments with E. coli

  • Mutation analysis approaches:

    • Implement whole-genome sequencing at defined intervals

    • Develop high-throughput phenotyping assays for transport function

    • Track genetic changes using molecular markers

    • Create allelic replacement strains to verify adaptive mutations

  • Horizontal gene transfer considerations:

    • Design experiments with strains lacking natural transformation capabilities

    • Consider the native E. coli lacking plasmids and functional prophages as in the LTEE

    • Monitor potential gene flow from environmental sources

    • Implement strict sterile techniques to prevent contamination

  • Fitness landscape characterization:

    • Map interactions between multiple mutations (epistasis)

    • Create libraries of intermediate genotypes

    • Measure fitness effects of individual and combined mutations

    • Apply mathematical modeling to predict evolutionary trajectories

These approaches can provide insights into how transport systems evolve under different selective pressures and reveal general principles of adaptive evolution in complex membrane proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.