Recombinant Escherichia coli N-acetylgalactosamine permease IID component (agaD)

Shipped with Ice Packs
In Stock

Description

Biological Function and Genetic Context

The agaD gene encodes the EIID domain of the galactosamine-specific PTS (IIGam), which is part of a bipartite transport system shared with the GalNAc-specific PTS (IIAga). Key features include:

  • Dual PTS Functionality: The agaBCD operon encodes IIGam components (IIB: agaB, IIC: agaC, IID: agaD), while agaVWE encodes IIAga components. Both systems share a common IIA domain (agaF) for phosphorylation .

  • Metabolic Pathway: After transport, GalNAc-6-phosphate undergoes deacetylation by AgaA, while GalN-6-phosphate is deaminated by AgaI or AgaS, funneling metabolites into glycolysis .

Table 1: PTS Components for GalNAc and GalN Utilization

ComponentGalNAc (IIAga)GalN (IIGam)Shared Domain
IIBagaB
IICagaWagaC
IIDagaEagaD
IIAagaFagaFagaF

Functional Insights

  • Mutation Studies: A Gly91Ser substitution in agaF (shared IIA domain) disrupts GalNAc utilization in E. coli O157:H7, highlighting agaD’s dependence on functional agaF for PTS activity .

  • Evolutionary Conservation: The agaBCD operon is absent in non-pathogenic E. coli K-12 due to a chromosomal deletion, explaining its inability to metabolize GalN .

Regulatory and Pathway Interactions

  • Transcriptional Control: The aga regulon is governed by the AgaR repressor, which derepresses in the presence of GalNAc/GalN .

  • Cross-Pathway Links: Mutations in gat (galactitol) or nag (N-acetylglucosamine) genes can suppress agaD defects, enabling compensatory GalNAc utilization .

Future Directions

  • Biochemical Assays: Recombinant agaD enables reconstitution of PTS complexes to study transport kinetics .

  • Pathogen Studies: Investigating agaD’s role in E. coli O157:H7 pathogenesis could reveal nutrient scavenging mechanisms in hostile environments .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
agaD; yraF; b3140; JW3109; N-acetylgalactosamine permease IID component; EIID-Aga; PTS system N-acetylgalactosamine-specific EIID component
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
agaD
Target Protein Sequence
MGSEISKKDITRLGFRSSLLQASFNYERMQAGGFTWAMLPILKKIYKDDKPGLSAAMKDN LEFINTHPNLVGFLMGLLISMEEKGENRDTIKGLKVALFGPIAGIGDAIFWFTLLPIMAG ICSSFASQGNLLGPILFFAVYLLIFFLRVGWTHVGYSVGVKAIDKVRENSQMIARSATIL GITVIGGLIASYVHINVVTSFAIDNTHSVALQQDFFDKVFPNILPMAYTLLMYYFLRVKK AHPVLLIGVTFVLSIVCSAFGIL
Uniprot No.

Target Background

Function
The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) is a major carbohydrate active transport system. It catalyzes the phosphorylation of incoming sugar substrates concurrently with their translocation across the cell membrane. This system is involved in N-acetylgalactosamine transport.
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the agaD gene in Escherichia coli and what is its role in N-acetylgalactosamine metabolism?

The agaD gene in Escherichia coli encodes the N-acetylgalactosamine permease IID component, which is part of the phosphotransferase system (PTS) involved in the transport and phosphorylation of N-acetylgalactosamine (GalNAc). This gene belongs to the N-acetylgalactosamine (GalNAc) and galactosamine (GalN) utilization pathway, which is highly variable among different bacteria. The GalNAc/GalN utilization pathways in Proteobacteria include multiple novel genes with specific functional roles, with most pathway variations attributed to amino sugar transport, phosphorylation, and deacetylation steps .

The agaD gene functions as part of a complex system that enables E. coli to utilize GalNAc as a carbon source. The pathway involves multiple steps including transport, phosphorylation, deacetylation, and further metabolism of the amino sugar. Understanding this pathway is crucial for research into bacterial metabolism and potential biotechnological applications.

How does the agaD gene differ from other components of the N-acetylgalactosamine utilization pathway?

The agaD gene encodes a specific membrane component of the phosphotransferase system, distinguishing it from other genes in the N-acetylgalactosamine utilization pathway that encode different enzymatic functions. The N-acetylgalactosamine utilization pathway includes several other key components:

  • AgaK: Functions as a GalNAc kinase

  • AgaA II: A novel variant of GalNAc-6-phosphate deacetylase

  • AgaS: Acts as a GalN-6-phosphate deaminase

While agaD is involved in the transport and initial phosphorylation of GalNAc, these other enzymes participate in the subsequent steps of GalNAc metabolism. Unlike the downstream catabolic enzymes which are largely conserved across bacteria, the transport components like agaD show higher variation among different bacterial species, reflecting adaptation to different environmental niches and substrate availability.

What are the standard methods for cloning the agaD gene from Escherichia coli?

Standard methods for cloning the agaD gene from Escherichia coli typically follow molecular biology techniques adapted for membrane proteins. The process involves:

  • Primer design: Design specific primers that flank the full-length coding regions of the agaD gene, potentially including restriction enzyme sites for subsequent cloning steps. Similar approaches have been documented for other bacterial genes, as seen in the PCR amplification of agaS and agaY genes using specific primers .

  • PCR amplification: Extract genomic DNA from E. coli and use PCR to amplify the agaD gene.

  • Cloning vector selection: Choose an appropriate expression vector depending on the experimental goals. For membrane proteins like agaD, vectors with inducible promoters such as the lac promoter in pUC118 can be used .

  • Transformation and selection: Transform the recombinant plasmid into a suitable E. coli strain and select transformants using appropriate antibiotics.

For validation of gene function, techniques such as gene replacement with resistance cassettes using Lambda Red-mediated gene replacement method have been employed in E. coli, as demonstrated for agaS and agaI genes .

What strategies can optimize the expression of recombinant agaD in Escherichia coli systems?

Optimizing expression of recombinant agaD in Escherichia coli requires addressing several challenges associated with membrane protein expression. Based on studies with similar recombinant proteins, the following strategies have proven effective:

  • Promoter selection: Using physiologically-regulated promoters rather than constitutive ones can significantly increase protein production. For instance, promoters regulated under σs transcription factor have shown increased recombinant protein activity, as observed with rhGALNS expression .

  • Osmotic stress application: Applying osmotic shock has been demonstrated to improve proper protein folding and activity of recombinant proteins. When combined with appropriate promoters, this approach can enhance functional protein production .

  • Chaperone co-expression: Although not always effective (as seen with rhGALNS where chaperone overexpression did not improve activity), co-expression of molecular chaperones can be attempted to aid proper folding of complex membrane proteins .

  • Disulfide bond formation enhancement: For proteins requiring disulfide bonds, enhancing cytoplasmic disulfide bond formation can improve functional protein yield .

  • Culture conditions optimization: Using high concentrations of osmolytes such as sucrose in conjunction with appropriate promoters (like proU mod) has been shown to significantly increase both production and activity of recombinant proteins .

These strategies should be tested systematically through experimental design approaches that allow for the evaluation of multiple factors simultaneously, similar to the autonomous kinetic model identification approaches used in other biochemical studies .

How can researchers effectively design experiments to investigate the functional properties of recombinant agaD?

Designing effective experiments to investigate recombinant agaD functional properties requires a systematic approach:

  • Establish clear research questions: Define specific hypotheses about agaD function, such as substrate specificity, transport kinetics, or interaction with other pathway components.

  • Apply model-based design of experiments (DOE): Utilize optimal experimental design methods to maximize information gain while minimizing experimental effort. This approach has been successfully applied in kinetic model identification studies, where automation and feedback optimization were combined to rapidly validate models .

  • Implement sequential decision-making: Design experiments that build upon previous results, autonomously switching between objectives to discriminate between competing models and minimize parametric uncertainty .

  • Focus on uncertainty reduction: Design experiments specifically aimed at reducing uncertainty in parameter estimates, which is crucial for membrane transport proteins like agaD where functional characterization can be challenging .

  • Consider in vitro reconstruction: For functional validation, consider reconstituting partial pathways in vitro with purified components, similar to the approach used to validate the three-step pathway involving AgaK, AgaA II, and AgaS from Shewanella sp. ANA-3 .

  • Include genetic validation: Utilize gene deletion and complementation studies to confirm gene function in vivo, following methodologies similar to those used for agaS and agaI in E. coli ATCC 8739 .

These approaches should be integrated within a comprehensive experimental plan that connects research objectives to appropriate experimental designs, as highlighted in quality experimental design practices .

What are the challenges in expressing and purifying functional recombinant agaD compared to other membrane proteins?

Expressing and purifying functional recombinant agaD presents several specific challenges compared to other membrane proteins:

  • Protein aggregation: Like many membrane proteins, recombinant agaD may form insoluble aggregates rather than properly inserted membrane proteins. This challenge has been observed with other recombinant proteins where most of the product is present as protein aggregates .

  • Toxicity to host cells: Overexpression of membrane proteins can disrupt host cell membrane integrity, leading to growth inhibition and reduced protein yields.

  • Post-translational modifications: If agaD requires specific post-translational modifications for activity, these may not occur correctly in recombinant systems.

  • Proper membrane insertion: Ensuring correct insertion and orientation of agaD in the membrane is critical for function but technically challenging.

  • Stability during purification: Membrane proteins often lose stability and activity during detergent-based extraction and purification steps.

To address these challenges, researchers should consider:

  • Using specialized E. coli strains designed for membrane protein expression

  • Employing physiologically-regulated promoters that have shown promise for other difficult-to-express proteins

  • Applying osmotic shock treatments which have demonstrated benefits in improving protein folding and activity

  • Testing various detergents and stabilizing agents during purification

  • Considering fusion tags that can enhance solubility while maintaining function

What statistical approaches are most appropriate for analyzing kinetic data from recombinant agaD transport studies?

Analyzing kinetic data from recombinant agaD transport studies requires robust statistical approaches that account for the complexities of membrane transport processes:

  • Model selection criteria: Utilize statistical criteria such as Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC) to discriminate between competing kinetic models of transport. This approach aligns with autonomous kinetic model identification methodologies used in related biochemical studies .

  • Uncertainty quantification: Apply methods that provide not just point estimates of kinetic parameters, but also confidence intervals that reflect experimental uncertainty. This enables assessment of parameter precision and model reliability .

  • Global sensitivity analysis: Implement sensitivity analysis to identify which parameters most strongly influence the model predictions, helping to focus experimental efforts on the most critical measurements.

  • Bayesian parameter estimation: Consider Bayesian approaches that can incorporate prior knowledge about transport kinetics and update these beliefs based on experimental data.

  • Experimental design optimization: Use D-optimal or E-optimal design criteria to maximize information content in experiments specifically designed to estimate kinetic parameters .

  • Retrospective data analysis: Employ methods to study model behavior within uncertainty limits, ensuring that the resulting models are not just statistically valid but also practically useful as predictive tools .

These statistical approaches should be implemented within a framework that connects research objectives to appropriate experimental designs and analysis methods, as emphasized in quality research design practices .

How can researchers validate the functionality of recombinant agaD in heterologous expression systems?

Validating the functionality of recombinant agaD in heterologous expression systems requires multiple complementary approaches:

  • Transport assays: Develop specific assays to measure N-acetylgalactosamine uptake in cells expressing recombinant agaD compared to control cells. These assays may use radioactively labeled or fluorescently tagged substrates.

  • Complementation studies: Express recombinant agaD in E. coli strains with deletions in the native agaD gene to determine if the recombinant protein can restore the wild-type phenotype. This approach has been successfully used for validating other components of the agaD pathway, such as demonstrating that AgaS functions as the main GalN-6-P deaminase in E. coli .

  • In vitro reconstitution: Purify recombinant agaD and reconstitute it into liposomes or proteoliposomes to directly measure transport activity in a defined system, similar to in vitro validation approaches used for enzymes in the GalNAc catabolic pathway .

  • Protein localization: Use techniques such as membrane fractionation, GFP fusion proteins, or immunolocalization to confirm that recombinant agaD is correctly localized to the membrane.

  • Interaction studies: Investigate interactions between agaD and other components of the phosphotransferase system using techniques such as bacterial two-hybrid systems or co-immunoprecipitation.

  • Enzymatic coupling assays: Develop coupled assays where transport via agaD is linked to subsequent steps in the GalNAc utilization pathway, potentially using purified enzymes such as AgaK, AgaA II, and AgaS in reconstituted systems .

These validation approaches provide multiple lines of evidence for functional expression, increasing confidence in experimental results.

What are the key considerations for experimental design when studying agaD gene expression regulation?

When studying agaD gene expression regulation, researchers should consider these key experimental design factors:

  • Regulatory networks identification: Design experiments to identify potential transcriptional regulators of agaD, considering that N-acetylgalactosamine utilization pathways often have specific regulatory systems, such as the AgaR transcriptional regulon in Proteobacteria .

  • Promoter characterization: Map the promoter region of agaD and identify binding sites for regulatory proteins. Similar to studies with other genes, consider both the core promoter elements and potential regulatory sequences.

  • Environmental conditions: Systematically vary environmental conditions known to affect carbon source utilization genes, including carbon source availability, growth phase, and stress conditions.

  • Genetic background effects: Test expression in various E. coli strains or in strains with mutations in potential regulatory genes to understand the genetic context requirements for proper regulation.

  • Transcriptional fusions: Create reporter gene fusions (e.g., with lacZ or fluorescent proteins) to quantitatively measure promoter activity under different conditions.

  • Global regulatory networks: Consider the integration of agaD regulation within broader regulatory networks, including global regulators like cAMP receptor protein (CRP) or catabolite repression.

  • Statistical experimental design: Apply factorial or response surface methodology experimental designs to efficiently explore multiple factors simultaneously and identify interactions between factors .

  • Data collection planning: Ensure adequate replication and appropriate controls, considering the inherent variability in gene expression measurements. The experimental design should include determination of the required number of replicates to achieve statistical power .

  • Time-course measurements: Include time-resolved measurements to capture the dynamics of gene expression regulation rather than only endpoint measurements.

These considerations should be integrated within a comprehensive experimental plan that connects research objectives to appropriate designs, as emphasized in quality experimental design practices .

How does the function of agaD in Escherichia coli compare to homologous proteins in other bacterial species?

The function of agaD in Escherichia coli exhibits both conservation and divergence when compared to homologous proteins in other bacterial species:

  • Functional conservation: The core function of agaD as a component of the phosphotransferase system for N-acetylgalactosamine transport is conserved among diverse Proteobacteria that can utilize GalNAc as a carbon source .

  • Pathway variations: Despite functional conservation, significant variations exist in the N-acetylgalactosamine utilization pathways across bacterial species, particularly in the transport, phosphorylation, and deacetylation steps. These variations likely reflect adaptation to different ecological niches .

  • Taxonomic distribution: Comparative genomic analyses reveal that while the downstream catabolic enzymes in the pathway are largely conserved, the transport components, including agaD homologs, show greater diversity across bacterial taxa .

  • Substrate specificity: In some bacterial species, the homologous transporters may have broader or narrower substrate specificity compared to E. coli agaD, potentially transporting related amino sugars.

  • Regulatory differences: The regulation of agaD expression varies significantly across bacterial species, with different transcriptional regulators controlling GalNAc utilization genes in different taxonomic groups of Proteobacteria .

  • Structural adaptations: Homologous proteins may show structural adaptations to different membrane compositions or environmental conditions while maintaining similar functional roles.

These comparative insights provide important context for understanding the evolution of carbohydrate utilization pathways and can inform strategies for heterologous expression of agaD in different host systems.

What methodologies are most effective for studying protein-protein interactions involving agaD in the phosphotransferase system?

Studying protein-protein interactions involving agaD in the phosphotransferase system requires specialized methodologies appropriate for membrane protein complexes:

  • Bacterial two-hybrid systems: Adapted versions of two-hybrid systems specifically designed for membrane proteins can detect interactions between agaD and other components of the phosphotransferase system in a cellular context.

  • Co-immunoprecipitation: Using antibodies against agaD or epitope-tagged versions of the protein to pull down interaction partners, followed by mass spectrometry identification.

  • Cross-linking coupled with mass spectrometry: Chemical cross-linking of protein complexes in their native membrane environment, followed by identification of cross-linked peptides can reveal direct interaction interfaces.

  • FRET-based approaches: Fluorescence resonance energy transfer between fluorescently labeled components can detect interactions and potentially measure interaction dynamics in living cells.

  • Surface plasmon resonance: For interactions between purified components, SPR can provide quantitative binding kinetics and affinity measurements.

  • Genetic approaches: Suppressor mutation analysis or genetic complementation studies can reveal functional interactions, as demonstrated for other components of the GalNAc utilization pathway .

  • Structural biology techniques: Techniques like cryo-electron microscopy are increasingly being applied to membrane protein complexes and could reveal the structural basis of agaD interactions within the phosphotransferase system.

These methodologies should be applied within a framework of hypothesis-driven research that connects experimental approaches to clear research questions, as emphasized in quality research design practices .

What are the potential applications of recombinant agaD in biotechnology and metabolic engineering?

Recombinant agaD offers several potential applications in biotechnology and metabolic engineering:

  • Biosensor development: Engineered cells expressing agaD could serve as biosensors for detecting N-acetylgalactosamine in environmental or biological samples, providing a specific and sensitive detection method.

  • Metabolic pathway engineering: Incorporation of agaD into engineered metabolic pathways could enable efficient utilization of N-acetylgalactosamine as a carbon source for the production of value-added compounds.

  • Glycobiology research tools: Systems expressing functional agaD could facilitate studies on amino sugar metabolism and cell wall biosynthesis pathways, which are important in both basic research and drug development.

  • Bioremediation: Engineered bacteria expressing agaD could potentially be used for the bioremediation of amino sugar-containing waste streams from various industrial processes.

  • Model system for membrane protein studies: Optimized expression systems for agaD could serve as models for other challenging membrane proteins, particularly those involved in carbohydrate transport.

  • Enzyme therapy development: The methodologies developed for improving production of recombinant membrane proteins like agaD could inform approaches for producing therapeutic enzymes, such as those used in enzyme replacement therapies for lysosomal storage diseases .

For these applications, researchers should consider the optimized expression strategies that have been successful for other challenging proteins, such as using physiologically-regulated promoters and osmotic shock treatments to improve proper folding and activity .

How can data management and analysis protocols be optimized for research on agaD and related genes?

Optimizing data management and analysis protocols for agaD research requires a comprehensive approach:

  • Standardized data collection: Implement standardized protocols for collecting experimental data on agaD expression, function, and interactions to facilitate comparison across different studies and laboratories. This should include considerations for proper randomization and determination of required replicates .

  • Data sharing infrastructure: Utilize institutional or consortium-based data sharing platforms, similar to those described by Georgetown University's Office of Assessment and Decision Support (OADS), to facilitate secure access to research data for collaborative projects .

  • Formal review processes: Consider implementing review processes for data access and usage, similar to the Administrative Data Review Panel (ADRP) approach, especially for sensitive or proprietary data .

  • Data security protocols: Develop appropriate data security guidelines, particularly for datasets involving human subjects, ensuring data is de-identified and potentially providing synthetic datasets that mirror real data for initial analyses .

  • Integrated analysis environments: Where possible, grant research team members direct access to secure data analysis environments rather than transferring data files, enhancing both security and collaboration .

  • Statistical analysis planning: Connect research objectives to appropriate statistical methods, ensuring proper model selection and parameter estimation approaches, particularly for complex kinetic data .

  • Meta-analytic thinking: Adopt meta-analytic approaches that emphasize effect sizes and uncertainty quantification rather than merely statistical significance, integrating results across multiple studies and experimental approaches .

  • Retrospective data analysis: Implement methods to study model behavior within uncertainty limits, ensuring that results are not only statistically valid but also practically useful as predictive tools .

These protocols should be integrated within a comprehensive research data management plan that ensures data quality, accessibility, and long-term preservation while facilitating collaborative research.

What are the key structural and functional properties of agaD protein in Escherichia coli?

PropertyDescriptionReference
Gene LengthThe agaD gene in related bacterial systems can be approximately 1300-1400 bp
Protein FamilyMember of the phosphotransferase system (PTS)
Subcellular LocalizationIntegral membrane protein
FunctionTransport and phosphorylation of N-acetylgalactosamine
Pathway AssociationPart of the N-acetylgalactosamine utilization pathway
Regulatory ControlSubject to regulation by specific transcriptional regulators in the AgaR regulon
Evolutionary ConservationTransport components show greater diversity across bacterial taxa compared to downstream catabolic enzymes

What experimental conditions have been optimized for recombinant protein expression in E. coli systems?

ParameterOptimized ConditionEffect on Protein ExpressionReference
Promoter TypePhysiologically-regulated promoters (e.g., under σs regulation)Increased recombinant protein activity
Osmotic ConditionsApplication of osmotic shockImproved protein folding and activity
Chaperone Co-expressionOverexpression of native chaperonesVaries by protein; not always beneficial
Disulfide Bond FormationEnhancement of cytoplasmic disulfide bond formationMay improve folding of disulfide-containing proteins
Medium AdditivesHigh concentrations of sucroseSignificantly increased production and activity when used with appropriate promoters (e.g., proU mod)
Expression TemperatureLower temperatures (typically 16-30°C)Often improves folding of complex proteins
Induction ConditionsMild induction with lower inducer concentrationsMay reduce aggregation and improve folding

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.