Recombinant Escherichia coli NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
nuoA; EcolC_1364; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is considered the primary electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, conserving energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is nuoA and what is its functional significance in Escherichia coli?

NuoA is a subunit of the NADH dehydrogenase complex (also known as Complex I) in Escherichia coli. It functions as a transmembrane (TM) protein and is part of the respiratory chain responsible for energy conversion in bacterial cells. The protein plays an essential role in electron transport and proton translocation across the bacterial membrane, contributing to the generation of the proton motive force that drives ATP synthesis.

NuoA has been studied extensively as a model for understanding membrane protein topology and insertion mechanisms. Research has confirmed that nuoA has an "N out" orientation, meaning its N-terminus is located in the periplasmic space rather than the cytoplasm of E. coli . This orientation is critical for the proper assembly and function of the entire NADH dehydrogenase complex in the bacterial respiratory chain.

How can I determine if my recombinant nuoA construct maintains its native structure?

Determining whether your recombinant nuoA maintains its native structure requires multiple validation approaches:

  • Membrane topology analysis: Verify that the N-terminus maintains its "out" orientation in the periplasm using fusion protein constructs such as D94N or D94N-3TM as described in membrane protein topology studies .

  • Functional assays: Measure NADH dehydrogenase activity to confirm that the recombinant protein retains its electron transport capabilities.

  • Structural characterization: Use circular dichroism (CD) spectroscopy to assess secondary structure elements and compare them to known profiles for properly folded nuoA.

  • Protein-protein interaction studies: Verify that the recombinant nuoA can properly interact with other subunits of the NADH dehydrogenase complex.

  • Membrane integration analysis: Confirm proper insertion into the membrane using biochemical fractionation and Western blotting techniques.

A properly folded recombinant nuoA should demonstrate similar biochemical characteristics to the native protein and maintain its correct membrane topology, which is crucial for its function in the respiratory chain.

What expression systems are most effective for producing recombinant nuoA?

The expression of membrane proteins like nuoA presents significant challenges compared to soluble proteins. Based on research data, the following expression systems have proven most effective:

Table 1: Comparison of Expression Systems for Recombinant nuoA Production

Expression SystemAdvantagesLimitationsYield (mg/L)Recommended Applications
E. coli BL21(DE3)Native environment, low cost, rapid growthPotential toxicity, inclusion body formation0.5-2.0Initial screening, mutagenesis studies
C41(DE3)/C43(DE3)Adapted for membrane protein expressionLower yield than specialized systems1.0-3.0Functional studies, topology analysis
LEMO21(DE3)Tunable expression, reduced toxicityRequires optimization2.0-4.0Structural studies, large-scale production
Cell-free systemsAvoids toxicity issues, rapidExpensive, may require detergents0.1-0.5Difficult-to-express variants

For optimal nuoA expression, statistical experimental design methodology is highly recommended over the traditional univariant approach. Multivariant analysis allows researchers to evaluate the effects of multiple variables simultaneously, characterize experimental error, and gather high-quality data with fewer experiments . This approach is particularly valuable for optimizing culture medium compositions and process conditions for recombinant protein expression.

How can I optimize the solubility of recombinant nuoA during expression?

Optimizing the solubility of recombinant nuoA requires careful consideration of multiple parameters:

  • Temperature modulation: Lower expression temperatures (16-25°C) often improve proper folding and membrane insertion of nuoA by slowing down protein synthesis rate.

  • Inducer concentration: Use statistical experimental design to determine optimal inducer concentrations. For IPTG-based systems, concentrations between 0.1-0.5 mM typically provide a balance between expression level and proper folding.

  • Medium composition: Supplement with additives that support membrane protein folding, such as glycerol (5-10%) which can stabilize membrane structures.

  • Co-expression strategies: Consider co-expressing nuoA with chaperones that assist in membrane protein folding.

  • Expression timing: Harvest cells during the optimal phase of growth when membrane protein insertion machinery is most efficient.

The use of factorial designs, as highlighted in research literature, allows for the rapid and economical determination of optimal culture conditions with fewer experiments and minimal resources . When applying multivariant analysis to optimize nuoA expression, researchers can simultaneously evaluate the effects of multiple variables (temperature, inducer concentration, media composition, etc.) and identify significant interactions between these factors that might be missed using traditional one-variable-at-a-time approaches.

What methods can effectively determine the N-terminal orientation of recombinant nuoA in the E. coli membrane?

Determining the N-terminal orientation of membrane proteins like nuoA is crucial for understanding their function and structure. Several methods have been developed for this purpose:

  • Fusion protein approach: The research describes a novel method using D94N and D94N-3TM fusion partners to determine N-terminal orientation without relying on mutagenesis, structural determination, or chemical labeling . This approach offers a quick and straightforward way to assess whether the N-terminus is oriented inward (toward the cytoplasm) or outward (toward the periplasm).

  • Expression level comparison: When nuoA (an N-out protein) is fused with D94N-3TM, it shows better expression compared to fusion with D94N. This is because both the C-terminal of D94N-3TM and the N-terminal of nuoA are located in the periplasm, creating a compatible topological arrangement .

  • Western blot visualization: This technique allows for direct comparison of expression levels between different fusion constructs, providing evidence for the orientation of the N-terminus based on expression efficiency.

  • Comparative analysis: By comparing the expression patterns of known N-out proteins (like nuoA, nuoJ, and NarI) with proteins of unknown orientation, researchers can infer the orientation of new target proteins .

This methodology is advantageous because it doesn't require extensive mutagenesis or chemical modifications that might alter the protein's native conformation. It provides a reliable approach to determine an important aspect of membrane protein topology that is often challenging to assess using conventional methods.

How does the membrane orientation of nuoA affect its function and interaction with other subunits?

The membrane orientation of nuoA is fundamental to its proper function within the NADH dehydrogenase complex. Research indicates several key implications:

Studies have shown that the N-terminal region is typically the first to be inserted into the plasma membrane through coordinated efforts involving the ribosome-nascent polypeptide complex and the translocon . This initial insertion step is crucial for establishing the correct orientation that enables nuoA to function properly within the respiratory chain complex.

How can large language models and computational approaches be applied to analyze contradictions in nuoA experimental data?

Large language models (LLMs) and computational approaches offer powerful tools for identifying and resolving contradictions in experimental data related to nuoA research:

This integration of computational approaches with traditional experimental methods creates a more robust research paradigm, enabling faster identification of genuine contradictions versus experimental artifacts or context-dependent variations in nuoA behavior.

What statistical approaches are most appropriate for analyzing variability in nuoA expression data?

When analyzing variability in nuoA expression data, several statistical approaches have proven particularly valuable:

  • Factorial experimental design: As described in the research literature, factorial designs allow researchers to determine significant effects, build models, evaluate variable effects, and search for optimum conditions . This approach is especially useful for optimizing nuoA expression conditions.

  • Orthogonal fractional designs: When dealing with more than four variables affecting nuoA expression (e.g., temperature, inducer concentration, media composition, strain selection), orthogonal fractional designs maintain statistical validity while reducing the number of required experiments .

  • Response surface methodology (RSM): This statistical technique helps identify optimal conditions for nuoA expression by creating a mathematical model that predicts protein yield based on multiple experimental variables.

  • Analysis of variance (ANOVA): ANOVA techniques allow researchers to determine which factors significantly influence nuoA expression and identify interactions between variables that might not be apparent when changing one factor at a time.

  • Principal component analysis: This approach can help identify patterns in complex datasets, revealing which combinations of factors have the greatest impact on successful nuoA expression.

The multivariant statistical method provides significant advantages over traditional univariant approaches by enabling researchers to characterize experimental error, compare the effects of variables between themselves when variables are normalized, and gather high-quality information with fewer experiments . These statistical techniques create a more efficient pathway to optimizing conditions for nuoA expression and study.

How can I optimize content to have my nuoA research featured in Google's People Also Ask results?

To increase the visibility of your nuoA research in Google's "People Also Ask" (PAA) features, consider the following optimization strategies:

  • Strategic content structuring: Google's PAA appears in approximately 80% of search queries . Creating content that directly answers common questions about nuoA increases the likelihood of being featured. Structure your research articles or supplementary materials with clear question-and-answer sections.

  • FAQ optimization: Develop comprehensive FAQ sections on research websites or publications that address both basic and advanced aspects of nuoA research. According to analysis, PAA features commonly appear for research-focused queries .

  • Answer comprehensiveness: When formulating answers about nuoA, provide concise yet complete information. The ideal PAA answer contains enough detail to be valuable but remains brief enough to fit in a snippet format .

  • Citation enhancement: Ensure your research includes proper citations to authoritative sources, as Google tends to favor well-supported content for PAA features, especially for scientific topics .

  • Question anticipation: Based on analysis of search patterns, anticipate the questions researchers might ask about nuoA and incorporate these questions and their answers naturally into your content .

Remember that being featured in PAA sections enhances your research's visibility and establishes your work as an authoritative source in the field. While PAA features may not generate large traffic volumes, they attract highly interested researchers who are more likely to engage deeply with your content .

What are common troubleshooting strategies for addressing inconsistent results in nuoA membrane topology studies?

When faced with inconsistent results in nuoA membrane topology studies, researchers should consider the following troubleshooting strategies:

By implementing these systematic troubleshooting approaches, researchers can identify the sources of inconsistency in their nuoA topology studies and develop more reliable experimental protocols for future investigations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.