Recombinant Escherichia coli NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant E. coli NADH-quinone oxidoreductase subunit K (nuoK) is a hydrophobic subunit of the bacterial proton-translocating NADH-quinone oxidoreductase (NDH-1), a respiratory enzyme homologous to mitochondrial complex I. NuoK is the smallest subunit of NDH-1, spanning three transmembrane segments (TM1–3) and playing a critical role in coupling electron transfer to proton translocation across the cytoplasmic membrane . Its structure and function are conserved in eukaryotic ND4L subunits, making it a key model for studying complex I mechanisms in mitochondrial diseases .

Membrane Topology and Subunit Interactions

NuoK forms a linear arrangement of three α-helices connected by short loops, interacting extensively with NuoN (ND2 homolog) and NuoL (ND5 homolog) . Its cytoplasmic loop-1 (residues 25–27) contains conserved arginines (Arg-25, Arg-26) critical for proton translocation .

Table 1: Impact of NuoK Mutations on NDH-1 Activity

MutationElectron Transfer Activity (%)Proton Translocation (%)Source
KGlu-36 → Ala00
KGlu-72 → Ala~50~40
R25A/R26A (loop-1)~20~10

Flexibility in Proton Channel Architecture

Repositioning KGlu-36 along TM2 (e.g., to positions 32, 38, 39, or 40) preserves NDH-1 activity, indicating structural flexibility in proton channel formation . This contrasts with rigid requirements for conserved residues like MGlu-144 in NuoM .

Assembly and Stability

NuoK mutants (e.g., KGlu-36 → Ala) assemble into NDH-1 but fail to generate membrane potential. Membrane vesicles with mutant nuoK show:

  • Oxonol VI Assays: No membrane potential generation .

  • ACMA Fluorescence: Loss of H⁺ pumping activity .

Role of Cytoplasmic Loop-1

Mutations in Arg-25/Arg-26 disrupt electrochemical gradient formation but not electron transfer, suggesting these residues stabilize proton channel dynamics .

Modeling Human Complex I Mutations

E. coli nuoK mutants serve as proxies for studying mitochondrial ND4L mutations. For example:

  • KGlu-72 → Ala: Mimics defects in proton translocation linked to mitochondrial diseases .

  • R25A/R26A: Explored for insights into proton channel gating mechanisms .

Mechanistic Hypotheses

NuoK’s Glu residues may:

  1. Coordinate Protons: Directly participate in H⁺ translocation via a relay mechanism.

  2. Stabilize Conformational States: Facilitate piston-like movements of antiporter-like subunits (NuoL, NuoM, NuoN) .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in stock. If you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Important note: All protein shipments are standardly sent with blue ice packs. If you require dry ice shipping, please inform us in advance as an additional fee will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development with the specified tag.
Synonyms
nuoK; ECSE_2536; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Escherichia coli (strain SE11)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation, transferring four hydrogen ions across the cytoplasmic membrane for every two electrons. This process conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.