Recombinant Escherichia coli Nickel transport system permease protein nikB (nikB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Nickel Transport System Permease Protein NikB (nikB)

The Recombinant Escherichia coli Nickel transport system permease protein NikB (nikB) is a crucial component of the NikABCDE system, which is responsible for nickel uptake in Escherichia coli. This system belongs to the ATP-binding cassette (ABC) transporter family and plays a vital role in maintaining nickel homeostasis within the cell, which is essential for various enzymatic functions, including those of urease and hydrogenase .

Structure and Function of NikB

NikB is one of the integral membrane components of the NikABCDE system, working alongside NikC to form a channel for nickel ions to pass through the cell membrane. The NikB protein is composed of 314 amino acids and is fused with an N-terminal His tag in recombinant forms, facilitating its purification and identification .

Role in Nickel Transport

The NikB protein, in conjunction with NikC, NikD, and NikE, facilitates the transport of nickel ions across the bacterial cell membrane. This process is crucial for the activation of nickel-dependent enzymes. The NikA protein acts as a periplasmic binding protein that captures nickel ions, which are then transported into the cytoplasm through the NikBC channel, driven by the ATP hydrolysis activity of NikDE .

Recombinant Production and Applications

Recombinant NikB is produced in Escherichia coli and is available as a lyophilized powder with a purity of greater than 90% as determined by SDS-PAGE. It is commonly used in research settings for studying nickel transport mechanisms and can be applied in various biochemical assays, such as SDS-PAGE .

Research Findings and Implications

Research on the NikB protein and the NikABCDE system has provided insights into the mechanisms of nickel transport in bacteria. This knowledge is crucial for understanding how bacteria maintain nickel homeostasis and how they adapt to environments with varying nickel concentrations. The study of nickel transport systems also has implications for biotechnology and environmental science, particularly in the development of strategies to mitigate metal toxicity in microbial systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nikB; b3477; JW3442; Nickel transport system permease protein NikB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
nikB
Target Protein Sequence
MLRYVLRRFLLLIPMVLAASVIIFLMLRLGTGDPALDYLRLSNLPPTPEMLASTRTMLGL DQPLYVQYGTWLWKALHLDFGISFASQRPVLDDMLNFLPATLELAGAALVLILLTSVPLG IWAARHRDRLPDFAVRFIAFLGVSMPNFWLAFLLVMAFSVYLQWLPAMGYGGWQHIILPA VSIAFMSLAINARLLRASMLDVAGQRHVTWARLRGLNDKQTERRHILRNASLPMITAVGM HIGELIGGTMIIENIFAWPGVGRYAVSAIFNRDYPVIQCFTLMMVVVFVVCNLIVDLLNA ALDPRIRRHEGAHA
Uniprot No.

Target Background

Function

Function: Involved in a bacterial nickel transport system; likely translocates nickel across the inner membrane.

Database Links
Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of NikB in the E. coli nickel transport system?

NikB functions as one of two integral membrane components in the E. coli nickel/peptide/opine ABC transporter family. The complete system consists of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPases (NikD and NikE) . This transport system does not coordinate Ni²⁺ directly but requires a metallophore for selective high-affinity binding of nickel ions . NikB, as a transmembrane component, creates the channel through which nickel ions pass across the cell membrane after initial binding to the periplasmic NikA protein. The protein's structure facilitates the conformational changes necessary for the transport process driven by ATP hydrolysis performed by the NikD and NikE components.

How is the nikABCDE operon regulated in E. coli?

The nikABCDE operon in E. coli is primarily regulated by the repressor protein NikR, which prevents nickel overload within the cell. When intracellular nickel concentration rises, Ni²⁺ binds to NikR, which then undergoes a conformational change enabling it to bind to the promoter region of the nikABCDE operon . This binding effectively blocks transcription, reducing expression of the transport system components including NikB, and consequently limiting further nickel uptake. This regulatory mechanism represents a critical homeostatic control system that balances the bacterial requirement for nickel in certain metabolic processes against the potential toxicity of excess nickel ions.

What are the challenges in studying integral membrane proteins like NikB?

Studying integral membrane proteins like NikB presents several significant challenges:

  • Protein solubility issues during extraction and purification

  • Difficulty in obtaining sufficient quantities of properly folded protein

  • Complications in crystallization for structural determination

  • Native environment requirements for maintaining functional conformation

  • Challenges in designing functional assays for transport activity

These challenges necessitate specialized approaches for successful investigation, including the use of detergents for solubilization, membrane mimetics for functional studies, and often, the creation of fusion constructs to enhance expression and purification .

What are the optimal conditions for soluble expression of recombinant NikB in E. coli?

Based on experimental design approaches for similar membrane proteins, the following conditions have been identified as optimal for maximizing soluble expression of membrane proteins like NikB:

  • Temperature: Lower temperatures (25°C) significantly improve soluble protein yield by reducing the rate of protein synthesis and allowing proper folding

  • Induction parameters: 0.1 mM IPTG has been determined to provide sufficient induction while minimizing protein aggregation

  • Growth phase: Induction at mid-log phase (OD₆₀₀ = 0.8) balances cell density with metabolic capacity

  • Media composition: Rich media supplemented with glucose as shown in Table 1 provides necessary resources for protein synthesis

Table 1: Optimized Media Composition for Membrane Protein Expression

ComponentConcentrationFunction
Yeast extract5 g/LProvides complex nutrients and cofactors
Tryptone5 g/LAmino acid source
NaCl10 g/LMaintains osmotic balance
Glucose1 g/LSupplies energy and carbon source
Kanamycin30 μg/mLSelection marker

Using the multivariate approach to optimization has demonstrated up to 250 mg/L yields of soluble membrane proteins with maintained functionality .

How can fusion tags improve the expression and purification of recombinant NikB?

Fusion tags can significantly enhance the expression, solubility, and purification of challenging membrane proteins like NikB through several mechanisms:

  • Solubility enhancement: Tags like MBP (maltose-binding protein), SUMO, or Thioredoxin can improve folding and reduce inclusion body formation by providing a well-folding domain that may assist in the folding of the attached protein

  • Affinity purification: Histidine tags (His₆) allow for efficient purification using immobilized metal affinity chromatography (IMAC), while other tags like GST permit one-step purification using glutathione resins

  • Detection enhancement: Tags such as GFP can serve as expression reporters and folding indicators, as proper GFP fluorescence only occurs when the fusion protein is correctly folded

  • Membrane targeting: Signal sequences can direct the recombinant protein to the proper cellular compartment, improving correct insertion into membranes

The strategic placement of the tag (N-terminal vs. C-terminal) should be determined empirically, as membrane topology may affect tag accessibility and protein functionality .

What co-expression strategies can improve the functional yield of recombinant NikB?

Co-expression strategies have proven highly effective for enhancing functional membrane protein production:

  • Chaperone co-expression: The co-expression of molecular chaperones such as GroEL/GroES or DnaK/DnaJ/GrpE has been shown to improve protein solubility by up to 38-fold for difficult-to-express proteins by assisting with proper folding and preventing aggregation

  • Partner protein co-expression: Co-expressing NikB with its natural partner proteins (NikC, NikA) may stabilize the protein structure and enhance proper membrane insertion

  • Foldase co-expression: Co-expression with foldases like DsbA and DsbC can facilitate proper disulfide bond formation, though this may be less critical for NikB which likely does not rely on disulfide bonds for structural integrity

  • Modified host strains: Utilizing specialized E. coli strains like SoluBL21™ that are engineered to enhance soluble expression of difficult proteins can improve yields

When implementing these strategies, it is critical to optimize plasmid compatibility, induction timing, and relative expression levels to achieve the desired outcome.

How can multivariate experimental design optimize NikB expression conditions?

Multivariate experimental design provides a powerful approach to optimize NikB expression by systematically evaluating multiple variables simultaneously:

  • Factorial design approach: A 2^n factorial design (where n is the number of variables) allows researchers to test combinations of variables to identify not only main effects but also interaction effects between variables

  • Key variables to consider include:

    • Temperature (18°C, 25°C, 30°C, 37°C)

    • Inducer concentration (0.01 mM to 1 mM IPTG)

    • Induction time (2h, 4h, 6h, overnight)

    • Media composition (minimal vs. rich media)

    • Addition of membrane-stabilizing additives (glycerol, specific detergents)

    • Presence of trace metals including nickel

  • Response variables should include:

    • Total protein yield

    • Soluble fraction percentage

    • Functional activity (transport assays or binding assays)

    • Membrane integration efficiency

As demonstrated in research with other recombinant proteins, statistical analysis of factorial design experiments can increase expression yields by identifying optimal conditions that might be missed using one-factor-at-a-time approaches . This method has been shown to increase soluble protein expression up to 250 mg/L with 75% homogeneity for challenging proteins .

What analytical methods are most effective for characterizing NikB membrane integration and topology?

Several complementary analytical methods provide insights into NikB membrane integration and topology:

  • Protease accessibility assays: Limited proteolysis of intact membrane vesicles versus disrupted membranes can reveal exposed regions of the protein

  • Cysteine scanning mutagenesis: Systematic replacement of amino acids with cysteine followed by accessibility studies with membrane-permeable and impermeable thiol-reactive reagents

  • GFP fusion analysis: Creating fusions with GFP at various positions and analyzing fluorescence localization in spheroplasts versus intact cells

  • PhoA/LacZ fusion approach: Fusions to alkaline phosphatase (active in periplasm) and β-galactosidase (active in cytoplasm) can identify domain orientation

  • Mass spectrometry of cross-linked peptides: Identifies interaction interfaces between transmembrane domains

Table 2: Analytical Methods for Membrane Protein Topology Determination

MethodInformation ProvidedTechnical ComplexityRequired Equipment
Protease accessibilityExposed domainsModerateBasic biochemistry
Cysteine scanningResidue-level accessibilityHighHPLC/LC-MS
GFP fusion analysisDomain localizationModerateFluorescence microscopy
PhoA/LacZ fusionDomain orientationModerateSpectrophotometer
Cross-linking MSInterface identificationVery highLC-MS/MS

How can isotope labeling enhance structural studies of NikB?

Isotope labeling techniques significantly expand the toolkit available for structural investigations of membrane proteins like NikB:

  • Uniform ¹⁵N/¹³C labeling: Growing recombinant E. coli in minimal media with ¹⁵NH₄Cl and ¹³C-glucose as sole nitrogen and carbon sources enables solution NMR studies of protein dynamics and ligand interactions

  • Selective labeling: Incorporating specific labeled amino acids allows targeted investigation of particular residues involved in metal binding or protein-protein interactions

  • Deuteration: Expression in D₂O-based media reduces proton-related signal complexity, enhancing the quality of NMR data for large membrane proteins

  • SAIL (Stereo-Array Isotope Labeling): Incorporating stereospecifically labeled amino acids further reduces spectral complexity

  • Segmental isotope labeling: Labeling specific domains of NikB would allow focused analysis of the transmembrane regions

These approaches can be particularly valuable for NikB structural studies when combined with methods like solid-state NMR that are well-suited to membrane protein analysis without requiring crystallization.

What mechanisms govern the selectivity of NikB for nickel versus other divalent metal ions?

The selectivity mechanisms of the NikABCDE transport system involve complex interactions across multiple components:

  • Primary selectivity appears to reside in the NikA periplasmic binding protein, which requires a metallophore for selective high-affinity binding of Ni²⁺

  • NikB likely contributes to selectivity through:

    • Specific coordination chemistry within the transmembrane channel

    • Amino acid residues that interact preferentially with nickel ions

    • Conformational changes that accommodate the hydrated ionic radius of nickel

  • Comparative studies with related systems: The NiCoT family of transporters exhibits varying metal specificities with some members preferring nickel while others favor cobalt . Analysis of sequence differences between these transporters and NikB can highlight residues responsible for selectivity.

  • Metal coordination geometry: Nickel typically prefers square planar or octahedral coordination geometry, and the transmembrane regions of NikB likely contain specific arrangement of metal-coordinating residues (histidine, aspartate, glutamate) that favor these geometries.

Research from related nickel/cobalt transport systems suggests that even small changes in the coordination environment can dramatically alter metal selectivity, with key histidine residues often playing critical roles in distinguishing between similar divalent cations .

How does the NikB-NikC heterodimer cooperate functionally in nickel transport?

The functional cooperation between NikB and NikC in the membrane domain of the nickel transport system involves sophisticated coordination:

  • Transmembrane channel formation: NikB and NikC together form the transmembrane pore through which nickel ions are transported, with each contributing transmembrane helices to create the translocation pathway

  • Conformational coupling: The heterodimer undergoes coordinated conformational changes during the transport cycle, alternating between inward-facing and outward-facing states in response to ATP binding and hydrolysis by the NikD and NikE ATPases

  • Asymmetric contributions: Based on studies of related ABC transporters, NikB and NikC likely make different contributions to the transport process despite their structural similarity, with specific residues in each protein performing unique roles in metal coordination and channel gating

  • Energetic coupling: The conformational changes in the NikB-NikC heterodimer must be precisely coupled to ATP hydrolysis events in the NikD-NikE complex to ensure efficient energy utilization during transport

This heterodimeric arrangement appears to be crucial for function, as evidenced by the conservation of the separate nikB and nikC genes across bacterial species possessing this transport system .

What are the current models for the complete transport cycle of the NikABCDE system?

Current models for the NikABCDE transport cycle integrate structural information from related ABC transporters with biochemical data specific to nickel transport:

  • Initiation phase:

    • Metallophore-bound Ni²⁺ associates with the periplasmic binding protein NikA

    • The NikA-Ni²⁺ complex interacts with the outward-facing conformation of the NikB-NikC transmembrane domain

  • Transition phase:

    • This interaction triggers ATP binding at the NikD-NikE nucleotide-binding domains

    • ATP binding induces dimerization of the NikD-NikE domains

    • The resulting conformational change is transmitted to NikB-NikC, converting the transmembrane domain from outward-facing to inward-facing

  • Release phase:

    • In the inward-facing conformation, Ni²⁺ is released into the cytoplasm

    • ATP hydrolysis resets the system, returning the complex to the outward-facing conformation

    • The transport cycle can then repeat

This model parallels the general mechanism of ABC transporters but incorporates the unique aspects of nickel transport, including metallophore involvement and the regulatory feedback provided by NikR when cytoplasmic nickel concentrations increase .

How can researchers develop functional assays to measure NikB-mediated nickel transport?

Developing robust functional assays for NikB-mediated nickel transport requires multiple complementary approaches:

  • Whole-cell accumulation assays:

    • Using radioactive ⁶³Ni to measure uptake rates in cells expressing wildtype versus mutant NikB

    • Competitive inhibition studies with other divalent cations to assess specificity

    • Measurement under varying conditions (pH, temperature, energy status)

  • Reconstituted systems:

    • Purified NikABCDE components reconstituted into proteoliposomes

    • Fluorescent nickel indicators entrapped in liposomes to measure transport kinetics

    • Inside-out membrane vesicle preparations for studying energy coupling

  • Binding assays:

    • Isothermal titration calorimetry (ITC) to measure binding affinity and thermodynamics

    • Fluorescence-based binding assays using intrinsic tryptophan fluorescence quenching

    • Surface plasmon resonance (SPR) to examine interaction kinetics

Table 3: Comparative Analysis of Nickel Transport Assay Methods

Assay TypeAdvantagesLimitationsSensitivity Range
Radioactive ⁶³Ni uptakeDirect measurement, high sensitivityRequires radioactive facilities, safety concernsnanomolar range
Fluorescent indicatorsReal-time measurement, non-radioactivePotential interference from other metalsmicromolar range
ITC bindingProvides thermodynamic parametersRequires significant protein amountsnanomolar to micromolar
Reconstituted proteoliposomesControlled environment, complete systemComplex preparation, technical challengesnanomolar range

What genetic approaches are most effective for studying NikB function in vivo?

Genetic approaches provide powerful tools for investigating NikB function within its native cellular context:

  • CRISPR-Cas9 genome editing:

    • Precise modification of the nikB gene with minimal disruption to the operon structure

    • Introduction of point mutations to test specific residue functions

    • Creation of fluorescent protein fusions at the genomic level

  • Complementation analysis:

    • Expression of mutant nikB variants in nikB deletion strains

    • Assessment of functional restoration using nickel-dependent phenotypes

    • Identification of dominant-negative mutants that interfere with wild-type function

  • Suppressor mutation screening:

    • Identification of second-site mutations that restore function to defective nikB mutants

    • Reveals functional interactions between different protein domains or different components of the transport system

  • Conditional expression systems:

    • Titratable expression to determine the relationship between NikB levels and transport capacity

    • Inducible expression for temporal control of NikB production

    • Tissue-specific expression in heterologous systems to assess function in different cellular environments

  • Reporter gene fusions:

    • Transcriptional fusions to monitor operon expression under various nickel conditions

    • Translational fusions to assess protein stability and localization

These approaches can be particularly powerful when combined with functional assays and structural studies to build a comprehensive understanding of NikB's role in nickel transport.

How can structural biology techniques be optimized for studying NikB?

Structural studies of membrane proteins like NikB require specialized approaches:

  • X-ray crystallography optimization:

    • Use of lipidic cubic phase (LCP) crystallization methods specifically designed for membrane proteins

    • Testing various detergents to identify those that maintain native structure while promoting crystal formation

    • Application of antibody fragment co-crystallization to provide additional crystal contacts

    • Construct optimization through removal of flexible regions or fusion with crystallization chaperones

  • Cryo-electron microscopy (cryo-EM) approaches:

    • Single-particle analysis of the complete NikABCDE complex

    • Use of nanodiscs or amphipols to maintain the membrane environment

    • Strategic antibody labeling to increase particle size and improve alignment

    • Focused classification to resolve conformational heterogeneity

  • Nuclear magnetic resonance (NMR) adaptations:

    • Solid-state NMR techniques for studying membrane-embedded proteins

    • Solution NMR of individual domains or carefully designed fragments

    • Selective labeling strategies to reduce spectral complexity

    • Paramagnetic relaxation enhancement (PRE) to obtain long-range distance constraints

  • Computational approaches:

    • Homology modeling based on related transporters with known structures

    • Molecular dynamics simulations to predict conformational changes during transport

    • Integrative modeling combining low-resolution experimental data with computational predictions

Each of these approaches has distinct advantages and limitations, and a comprehensive structural understanding of NikB will likely require integration of multiple techniques.

What emerging technologies might advance our understanding of NikB function?

Several cutting-edge technologies show particular promise for advancing NikB research:

  • Single-molecule transport assays:

    • Direct visualization of individual transport events using fluorescent nickel sensors

    • Correlation of conformational changes with transport steps

    • Measurement of transport kinetics without population averaging

  • In-cell structural biology:

    • NMR studies in living cells to examine NikB structure in its native environment

    • Fluorescence-detection size-exclusion chromatography (FSEC) for rapid screening of construct stability

    • In-cell cross-linking mass spectrometry to capture transient interactions

  • Microfluidics-based approaches:

    • High-throughput screening of expression conditions

    • Rapid assessment of functional variants

    • Real-time monitoring of transport in artificial cell systems

  • Advanced computational methods:

    • Deep learning approaches to predict membrane protein structure from sequence

    • Quantum mechanics/molecular mechanics (QM/MM) simulations to model metal coordination during transport

    • Systems biology modeling of the complete nickel homeostasis network

These technologies, particularly when used in combination, have the potential to resolve longstanding questions about the structural basis of metal selectivity and the precise molecular mechanisms of transport through the NikB-NikC channel.

How does NikB function compare across different bacterial species?

Comparative analysis of nikB homologs across diverse bacterial species reveals important insights:

  • Conservation patterns:

    • Core transmembrane domains show high sequence conservation, particularly in regions likely involved in metal coordination

    • Greater divergence in cytoplasmic loops suggests adaptation to different regulatory mechanisms

    • Species-specific insertions or deletions may reflect adaptation to different nickel requirements

  • Functional adaptations:

    • Extremophiles show modifications that maintain transport function under conditions of temperature or pH stress

    • Pathogenic bacteria may have evolved specialized features for nickel acquisition in host environments

    • Environmental isolates demonstrate varying metal specificities reflecting their ecological niches

  • Regulatory differences:

    • Variations in promoter regions suggest different regulatory control mechanisms

    • Alternative operon structures in some species indicate potential functional coupling to different metabolic pathways

    • Presence or absence of NikR binding sites correlates with differing nickel requirements

This comparative approach not only enhances our understanding of fundamental transport mechanisms but may also identify species-specific features that could be targeted for antimicrobial development .

What are the implications of NikB research for developing novel antimicrobial strategies?

Research on NikB and the nickel transport system has significant implications for antimicrobial development:

  • Targeting essential nickel-dependent processes:

    • Many pathogenic bacteria require nickel for virulence-associated enzymes such as urease

    • Inhibition of NikB could prevent nickel acquisition, indirectly inhibiting these essential processes

    • Species-specific differences in nickel transport systems could enable selective targeting

  • Structure-based drug design opportunities:

    • The unique structure of the NikB-NikC transmembrane domain could be exploited for designing specific inhibitors

    • Computational screening could identify compounds that block the translocation pathway

    • Allosteric inhibitors might lock the transporter in a non-functional conformation

  • Bacterial adaptation considerations:

    • Understanding the genetic basis of transporter specificity helps predict resistance mechanisms

    • Knowledge of alternative uptake pathways informs combination therapy approaches

    • Transport kinetics data enable rational dosing strategies for transport inhibitors

  • Diagnostic applications:

    • Identification of nikB sequence variations could provide rapid species identification

    • Expression levels of nikB could serve as biomarkers for metabolic state

    • Transport activity assays might assess antimicrobial efficacy in real-time

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.