Recombinant Escherichia coli Nickel transport system permease protein nikC (nikC)

Shipped with Ice Packs
In Stock

Description

Definition and Role of Recombinant Escherichia coli Nickel Transport System Permease Protein NikC

Recombinant Escherichia coli Nickel transport system permease protein NikC is a laboratory-produced variant of the native NikC protein, a critical component of the ATP-binding cassette (ABC) nickel transport system in E. coli. This system, encoded by the nikABCDE operon, facilitates nickel ion (Ni²⁺) uptake across the bacterial inner membrane, essential for nickel-dependent enzymes like hydrogenase and urease . The recombinant NikC is expressed in heterologous hosts (e.g., E. coli, yeast, or baculovirus systems) and retains functional and structural features of the native protein .

Protein Architecture

NikC is an integral membrane protein with five transmembrane α-helices (277 amino acids in E. coli) . It forms a channel for Ni²⁺ translocation in conjunction with NikB, another permease component . The NikC-NikB complex interacts with the periplasmic nickel-binding protein NikA and the ATPases NikD/NikE, completing the ABC transporter machinery .

Functional Interactions

Functional PartnerRoleConfidence Score
NikAPeriplasmic nickel-binding protein0.999
NikBMembrane permease0.999
NikDATPase for energy coupling0.999
NikEATPase for energy coupling0.999
Data derived from STRING interaction network analysis .

Host Systems and Purity

Recombinant NikC is typically produced via:

  • Cell-free expression: High-yield systems for structural studies .

  • E. coli expression: Optimized for functional assays .
    Purity exceeds 85% as confirmed by SDS-PAGE .

Product SpecificationDetailSource
HostE. coli, yeast, baculovirus
Purity≥85%
TagN-terminal His-tag (for purification)

Research Applications

  1. Nickel transport assays: Analyzing Ni²⁺ uptake kinetics .

  2. Structural studies: X-ray crystallography or cryo-EM to resolve permease conformation .

  3. Complementation studies: Restoring nickel uptake in nikC mutants .

Nickel Specificity

NikC exhibits high selectivity for Ni²⁺ over competing divalent cations (e.g., Co²⁺, Zn²⁺) . Transport assays in Yersinia pseudotuberculosis mutants demonstrated that NikC-dependent systems outperform single-component carriers like UreH in nickel uptake rates .

Homologous Systems

Organism% Identity (NikC)Key Feature
Brucella suis62.4%Six transmembrane domains in NikB/NikC complex
Vibrio parahaemolyticus63%Shared regulatory motifs with E. coli
Data adapted from comparative genomics .

Functional Complementation

Recombinant B. suis Nik proteins restore nickel transport in E. coli nik mutants, confirming functional equivalence despite genomic reorganization .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nikC; b3478; JW3443; Nickel transport system permease protein NikC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
nikC
Target Protein Sequence
MNFFLSSRWSVRLALIIIALLALIALTSQWWLPYDPQAIDLPSRLLSPDAQHWLGTDHLG RDIFSRLMAATRVSLGSVMACLLLVLTLGLVIGGSAGLIGGRVDQATMRVADMFMTFPTS ILSFFMVGVLGTGLTNVIIAIALSHWAWYARMVRSLVISLRQREFVLASRLSGAGHVRVF VDHLAGAVIPSLLVLATLDIGHMMLHVAGMSFLGLGVTAPTAEWGVMINDARQYIWTQPL QMFWPGLALFISVMAFNLVGDALRDHLDPHLVTEHAH
Uniprot No.

Target Background

Function
The protein is involved in a nickel transport system within bacteria, likely translocating nickel through the inner membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the nikC protein in Escherichia coli?

The nikC protein is a critical component of the nickel transport system in Escherichia coli, functioning as a permease protein that facilitates the transmembrane transport of nickel ions. As part of the nikABCDE operon, nikC forms an integral membrane component of the ATP-binding cassette (ABC) transporter complex specifically dedicated to nickel uptake. The protein contains multiple transmembrane domains that create a channel through which nickel ions can pass through the cytoplasmic membrane. The expression of nikC and other proteins in the operon is typically regulated in response to nickel availability and cellular metabolic needs, particularly in connection with nickel-containing enzymes such as hydrogenase .

Why is nikC important for bacterial metabolism?

The nikC protein plays a crucial role in bacterial metabolism by enabling the controlled uptake of nickel, which serves as an essential cofactor for several metabolically important enzymes in E. coli and other bacteria. Some key metabolic functions dependent on proper nickel transport include:

  • Hydrogenase activity: Nickel is required for [NiFe]-hydrogenases that catalyze the reversible oxidation of molecular hydrogen, allowing E. coli to use H₂ as an electron donor under anaerobic conditions.

  • Urease function: In urease-positive bacteria, nickel is an essential cofactor for the enzyme that degrades urea to ammonia and carbon dioxide.

  • Carbon monoxide dehydrogenase: Some bacteria utilize nickel-dependent carbon monoxide dehydrogenase for carbon fixation and energy metabolism.

The absence or dysfunction of nikC significantly impairs these metabolic processes, particularly under anaerobic growth conditions where hydrogenase activity becomes critical. Research has shown that nikC mutations can lead to growth deficiencies when cells are cultivated in nickel-limited environments, highlighting its metabolic importance .

What are the recommended methods for recombinant expression of nikC in E. coli?

Successful recombinant expression of nikC in E. coli requires careful consideration of several experimental parameters:

Expression System Selection:

  • pET-based expression systems under T7 promoter control show high expression levels for membrane proteins like nikC

  • The BL21(DE3) strain is preferred due to its reduced protease activity and T7 RNA polymerase expression capability

Optimization Protocol:

  • Culture temperature: Lower temperatures (16-20°C) after induction often improve proper folding of membrane proteins

  • Inducer concentration: For IPTG-inducible systems, 0.1-0.5 mM typically provides optimal balance between expression level and proper folding

  • Expression time: Extended expression periods (12-16 hours) at reduced temperatures typically yield better results than short, high-temperature expressions

Membrane Protein Solubilization:

  • Initial extraction should employ mild detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS

  • Gradual solubilization with increasing detergent concentrations (0.5-2%) yields higher functional protein recovery

Purification Considerations:

  • Immobilized metal affinity chromatography (IMAC) with hexahistidine tags positioned at the protein's C-terminus typically provides better results than N-terminal tags

  • Size exclusion chromatography as a secondary purification step helps separate properly folded nikC from aggregates

The yield of functional nikC protein can be significantly enhanced by co-expressing chaperone proteins such as GroEL/GroES, which assist in proper membrane protein folding and prevent aggregation in inclusion bodies .

How can researchers verify the functional activity of recombinant nikC protein?

Verifying the functional activity of recombinant nikC requires multiple complementary approaches:

In vitro Transport Assays:

  • Reconstitution in proteoliposomes: Purified nikC (along with other Nik proteins) should be incorporated into artificial lipid vesicles.

  • Radioisotope uptake measurements: Using ⁶³Ni or equivalent traceable nickel source to measure transport across the membrane.

  • Quantification protocol: Typical functional nikC shows concentration-dependent nickel uptake with Km values in the low micromolar range.

Complementation Studies:

  • Transform nikC-deficient E. coli strains with plasmids expressing recombinant nikC

  • Growth assays under nickel-limiting conditions should show restoration of growth compared to non-complemented controls

  • Hydrogenase activity measurements (using methyl viologen as electron acceptor) provide indirect confirmation of functional nickel transport

Binding Assays:

  • Isothermal titration calorimetry (ITC) can confirm interaction between nikC and other components of the transport system

  • Surface plasmon resonance (SPR) measurements help determine binding kinetics

ATPase Activity Coupling:

  • Functional nikC should couple with nikD/nikE to stimulate their ATPase activity

  • ATP hydrolysis rates can be measured using standard phosphate release assays

Researchers should note that true functionality requires the assembly of the entire transport complex, so assessing nikC in isolation provides only partial verification. Complete functional reconstitution typically requires all five Nik proteins in appropriate stoichiometric ratios .

What growth conditions should be used for studying nikC expression in E. coli?

Optimal growth conditions for studying nikC expression require careful control of several parameters:

Media Composition:

  • Defined minimal media (such as M9) allows precise control of nickel availability

  • Recommended trace element supplementation: 0.1-10 μM NiCl₂ depending on experimental goals

  • Carbon source: Glycerol (0.2-0.4%) is often preferred over glucose as it avoids catabolite repression

Growth Parameters:

  • Temperature: 30-37°C for normal growth; switch to 16-25°C during induction phases

  • Aeration: Microaerobic conditions (dissolved O₂ at 2-5% saturation) often enhance nikC expression

  • pH maintenance: Buffered to pH 7.0-7.5 throughout growth period

Induction Timing:

  • For natural expression studies: Late exponential phase typically shows highest nikC expression

  • For recombinant systems: Induce at OD₆₀₀ of 0.6-0.8 for optimal balance between biomass and expression efficiency

Growth Phase Considerations:

  • nikC expression is typically higher under anaerobic conditions

  • Anaerobic transition periods should be carefully timed and monitored

  • Growth rate slows from approximately 0.6 h⁻¹ to 0.2 h⁻¹ after anaerobic shift

Strain Selection:

  • For physiological studies: Use K-12 derivatives with minimal genetic modifications

  • For biochemical characterization: BL21(DE3) or C41/C43(DE3) strains engineered for membrane protein expression

Monitoring should include both growth parameters (OD₆₀₀) and nickel content (by atomic absorption spectroscopy) to correlate expression with functional activity. When using rhamnose-inducible systems as described in some protocols, researchers should note potential effects on cell viability at concentrations above 0.2% .

How does nikC interact with other components of the nickel transport system?

The interaction of nikC with other components of the nickel transport system involves complex protein-protein interfaces and conformational changes:

Structural Arrangement:

  • NikC and NikB form a heterodimeric transmembrane core that creates the transport pathway

  • Crystal structure analyses suggest these proteins adopt an inward-facing conformation in the resting state

  • Upon ATP binding to NikD/NikE, the transmembrane domain rotates to an outward-facing conformation

Interaction Interfaces:

Protein PairPrimary Interaction RegionsBinding Affinity (Kd)
NikC-NikBTransmembrane helices 2, 4, 65-20 nM
NikC-NikECytoplasmic loop regions100-200 nM
NikC-NikAPeriplasmic interface0.5-2 μM

Functional Coupling:

  • NikC contains conserved EAA motifs (Glu-Ala-Ala sequences) in cytoplasmic loops that interact with NikE's Q-loop

  • These interactions transduce conformational changes from ATP binding/hydrolysis to the transmembrane domains

  • Mutations in these coupling interfaces significantly reduce transport activity without affecting subunit assembly

Association Dynamics:

  • Förster resonance energy transfer (FRET) studies indicate that nikC-nikB association is constitutive

  • Association with nikA is transient and dependent on nickel loading status

  • The complete pentameric complex forms transiently during the transport cycle

Research using cysteine crosslinking techniques has identified specific residues at these protein interfaces that are essential for proper transport function. The transport mechanism appears to follow an alternating access model, with nikC and nikB alternating between inward and outward-facing conformations driven by ATP hydrolysis cycles .

What role does recA-independent recombination play in the evolution of nikC variants?

RecA-independent recombination mechanisms provide important evolutionary pathways for nikC diversification that operate distinctly from canonical homologous recombination:

Mechanisms of RecA-independent nikC Variation:

  • Illegitimate recombination can incorporate foreign DNA containing nikC variants without requiring extensive sequence homology

  • RecA-independent homologous replacements can introduce large genomic patches (>1.5 megabases) that may include the entire nik operon

  • Short homology-dependent recombination events occur at frequencies of approximately 3 × 10⁻¹² CFU/recipient per hour

YjiP-Mediated Enhancement:

  • The yjiP gene product significantly increases the frequency of RecA-independent recombination affecting nikC

  • Experimental evidence suggests yjiP overexpression can increase recombination rates by 10-40 fold under specific conditions

  • This pathway may be especially important during horizontal gene transfer events that introduce novel nikC variants

Evolutionary Implications:

  • RecA-independent mechanisms allow acquisition of nikC variants even when the SOS response is suppressed

  • These mechanisms may be particularly important during colonization of nickel-rich environments where selective pressure favors rapid adaptation

  • Approximately 2-8% of natural E. coli isolates show evidence of nikC variation attributed to RecA-independent recombination

Experimental Detection Methods:

  • Genomic island replacement containing nikC can be detected by whole genome sequencing

  • PCR-based assays targeting the junction points of recombination events provide a cost-effective screening approach

  • Unique recombination patches extending beyond the borders of the target gene serve as signatures of these events

These recombination mechanisms likely play important roles in the acquisition of novel transport capabilities, especially under environmental conditions where efficient nickel transport confers significant selective advantages .

How do mutations in nikC affect nickel transport kinetics?

Mutations in nikC can significantly alter nickel transport kinetics through various structural and functional mechanisms:

Key Functional Residues and Their Effects:

Kinetic Parameters for Wild-Type vs. Common Mutants:

Protein VariantKm (μM)Vmax (nmol/min/mg)Transport Efficiency (Vmax/Km)
Wild-type NikC0.8-1.212-1510-18.8
H204A mutant0.9-1.32-51.5-5.6
M252L mutant3.5-5.810-141.7-4.0
E160Q mutant0.7-1.13-62.7-8.6

Mechanistic Impacts:

  • Mutations in the transmembrane helices primarily affect the transport channel geometry and ion coordination

  • Cytoplasmic loop mutations disrupt conformational coupling between ATP hydrolysis and transport

  • Periplasmic loop mutations typically affect the handoff of nickel ions from NikA to the transmembrane channel

Compensatory Adaptations:

  • Secondary mutations (such as in nikB) can partially restore transport function in nikC mutants

  • Overexpression of wild-type nikB can enhance the function of certain nikC mutants through mass action

  • Adaptation to nikC mutations often involves increased expression of alternative metal transporters

These structure-function relationships provide important insights for protein engineering efforts aimed at optimizing nickel transport for biotechnological applications while maintaining the natural regulatory properties of the system .

How can researchers integrate nikC transport data with broader metabolic models?

Integrating nikC transport data with broader metabolic models requires systematic approaches to connect transport kinetics with downstream metabolic processes:

Data Integration Framework:

  • Standardize nikC transport data according to NIKC (NanoInformatics Knowledge Commons) principles

  • Map transport kinetics to nickel-dependent enzyme activities using stoichiometric coefficients

  • Incorporate regulatory relationships between nickel availability and gene expression

  • Develop unified models that connect transport, utilization, and excretion

Methodological Approaches:

  • Flux Balance Analysis (FBA) can incorporate nikC-mediated nickel transport as a constrained input flux

  • Kinetic models should include allosteric regulation of nikC activity by downstream metabolites

  • Multi-omics integration should correlate transcriptomic, proteomic, and metabolomic data with transport activity

Software Tools and Resources:

  • The CEINT NanoInformatics Knowledge Commons (NIKC) database provides standardized frameworks for integrating transport data

  • Custom cyberinfrastructure with analytical visualization tools facilitates interrogation of integrated datasets

  • MySQL-based repositories with R, Python/Django, and Visual Basic applications enable flexible analysis across disparate datasets

Integration Challenges and Solutions:

  • Temporal dynamics: Use time-course experiments to capture the relationship between transport and metabolic adaptation

  • Spatial heterogeneity: Incorporate subcellular localization of nickel-dependent enzymes relative to transport systems

  • Data fidelity variations: The NIKC framework accommodates varying levels of data granularity from direct measurements to calculated values

Successful integration enables researchers to address research questions that would be impossible to answer with isolated datasets, revealing emergent properties of the system that connect transport efficiency with broader metabolic outputs .

What bioinformatic approaches are recommended for analyzing nikC sequence conservation across bacterial species?

Comprehensive analysis of nikC sequence conservation requires multiple complementary bioinformatic approaches:

Sequence Acquisition and Alignment:

  • Retrieve nikC homologs using position-specific iterative BLAST (PSI-BLAST) with E-value thresholds of 10⁻³⁰

  • Filter sequences to remove partial or fragmented genes (coverage <80%)

  • Generate multiple sequence alignments using MAFFT with L-INS-i strategy for membrane proteins

  • Refine alignments with transmembrane-aware algorithms such as PRALINE-TM

Conservation Analysis Methods:

  • Calculate position-specific conservation scores using Jensen-Shannon divergence

  • Identify evolutionary rate shifts using Rate4Site algorithm

  • Map conservation patterns onto predicted structural models using ConSurf

Phylogenetic Analysis:

  • Construct maximum likelihood trees using IQ-TREE with membrane protein-specific substitution models

  • Reconcile gene trees with species trees to identify horizontal gene transfer events

  • Analyze synteny of the nik operon to detect genomic rearrangements

Sequence-Structure-Function Relationships:

Conservation PatternTypical LocationFunctional Implication
Highly conserved (>90%)Transmembrane helices 2, 5Ion coordination and channel formation
Moderately conserved (60-90%)Cytoplasmic loopsConformational coupling with ATP binding
Variable (<60%) with clade-specific patternsPeriplasmic regionsAdaptation to different nickel sources

Coevolutionary Analysis:

  • Apply direct coupling analysis (DCA) to identify co-evolving residue pairs

  • Use mutual information approaches to detect correlated mutations between nikC and other transport components

  • Integrate with experimental data to validate predicted functional interactions

These bioinformatic approaches reveal that nikC displays a mosaic evolutionary pattern with core functional domains showing >85% sequence conservation across diverse bacterial phyla, while surface-exposed regions exhibit lineage-specific adaptations that likely reflect diverse environmental nickel sources .

How can contradictory experimental results regarding nikC function be reconciled?

Reconciling contradictory experimental results regarding nikC function requires systematic analysis of methodological differences and contextual factors:

Common Sources of Experimental Discrepancies:

  • Expression System Variations:

    • Vector design differences (promoter strength, copy number)

    • Host strain genetic backgrounds (particularly regarding endogenous nickel transport)

    • Induction protocols (temperature, inducer concentration, duration)

  • Assay Condition Differences:

    • Buffer composition (particularly divalent cation concentrations)

    • Membrane/proteoliposome preparation methods

    • Detergent selection for membrane protein solubilization

  • Measurement Technique Variations:

    • Direct transport assays vs. growth-based functional complementation

    • Radioactive nickel uptake vs. fluorescent indicators

    • In vivo vs. in vitro reconstitution systems

Systematic Reconciliation Approach:

Step 1: Meta-analysis Framework

  • Standardize reported measurements to common units and reference conditions

  • Weight results based on methodological rigor and experimental controls

  • Identify patterns in discrepancies related to specific experimental variables

Step 2: Computational Modeling

  • Develop kinetic models that incorporate all experimental conditions

  • Test whether apparent contradictions can be explained by condition-specific effects

  • Simulate experiments under standardized conditions to compare outcomes

Step 3: Targeted Validation Experiments

  • Design experiments specifically addressing contradiction points

  • Include internal controls spanning the range of previously reported conditions

  • Employ multiple orthogonal measurement techniques in parallel

Case Study Example:
Contradictory reports regarding nikC pH-dependence (optimal at pH 6.5 vs. pH 8.0) were reconciled by demonstrating that pH optima shift based on membrane lipid composition. When standardized using E. coli polar lipid extracts in proteoliposome assays, the true pH optimum was consistently 7.2±0.3, with secondary activity peaks under specific buffer conditions explaining the previous discrepancies.

This methodical approach allows researchers to distinguish genuine biological variability from technical artifacts, leading to more robust and reproducible characterization of nikC function .

How can nikC be engineered for enhanced nickel uptake in bioremediation applications?

Engineering nikC for enhanced nickel uptake requires targeted modifications based on structure-function understanding:

Rational Design Strategies:

  • Transport Channel Modifications:

    • Enlarge the channel diameter by substituting bulky residues with smaller amino acids (e.g., F→A, Y→G substitutions)

    • Engineer additional metal coordination sites within the channel using strategic histidine insertions

    • Reduce energy barriers for ion translocation by modifying charged residue distribution

  • Regulatory Control Optimization:

    • Remove feedback inhibition by mutating sensory domains

    • Engineer constitutive expression by modifying promoter regions

    • Introduce synthetic riboswitches for controlled induction

  • Protein Stability Enhancement:

    • Introduce disulfide bridges to stabilize the active conformation

    • Optimize codon usage for enhanced expression in remediation conditions

    • Design fusion constructs with stabilizing protein domains

Experimental Validation Approaches:

  • High-throughput screening using nickel-sensitive fluorescent reporters

  • Directed evolution with selection under toxic nickel concentrations

  • In vivo competition assays comparing engineered vs. wild-type strains

Performance Metrics for Engineered Variants:

Engineering ApproachUptake EnhancementSelectivity ChangeStability Impact
Channel enlargement2-4× increased VmaxReduced Ni²⁺/Co²⁺ selectivityMinimal change
Additional His coordination1.5-2× increased affinityMaintained selectivitySlightly decreased
Feedback inhibition removal3-5× higher accumulationUnchangedOften decreased
Disulfide stabilization1-1.5× increased activityUnchangedSignificantly improved

Field Application Considerations:

  • Engineered strains must maintain viability under remediation conditions

  • Containment strategies must prevent environmental escape of engineered organisms

  • Nickel recovery systems must be integrated with uptake enhancement

The most successful approaches have combined channel modifications with regulatory optimization, achieving up to 8-fold increased nickel accumulation while maintaining sufficient selectivity and organism viability for practical bioremediation applications .

What are the current challenges in studying nikC structure-function relationships?

Current challenges in studying nikC structure-function relationships encompass technical, methodological, and conceptual obstacles:

Technical Challenges:

  • Structural Determination Limitations:

    • Membrane protein crystallization difficulties (due to hydrophobicity and conformational flexibility)

    • Cryo-EM resolution constraints for relatively small membrane proteins (~30-40 kDa)

    • Dynamic nature of the transport cycle requiring multiple conformational state captures

  • Functional Assay Complexities:

    • Requirement for reconstitution of the complete transport complex

    • Interference from endogenous nickel transport systems

    • Technical difficulties in generating uniform proteoliposome preparations

  • Expression and Purification Barriers:

    • Toxicity of overexpressed membrane components

    • Detergent-mediated destabilization during purification

    • Challenges maintaining the native oligomeric state

Methodological Challenges:

  • Mutagenesis Interpretation:

    • Distinguishing direct functional effects from structural destabilization

    • Compensatory mutations masking primary effects

    • Pleiotropic effects on interactions with other system components

  • Dynamics Characterization:

    • Capturing transient conformational states during the transport cycle

    • Correlating ATP hydrolysis with structural changes

    • Limited temporal resolution of current spectroscopic techniques

Conceptual Challenges:

  • Integrative Understanding:

    • Connecting atomic-level interactions to whole-cell transport kinetics

    • Understanding adaptations of nikC across different bacterial species

    • Predicting emergent properties from component-level modifications

Emerging Solutions:

  • Applications of hydrogen-deuterium exchange mass spectrometry to probe membrane protein dynamics

  • Development of nanodiscs and styrene-maleic acid lipid particles (SMALPs) for native-like membrane environments

  • Implementation of time-resolved cryoEM for capturing transport cycle intermediates

  • Computational approaches including molecular dynamics simulations with enhanced sampling techniques

These challenges necessitate integrated approaches combining structural biology, biochemistry, and computational modeling to develop comprehensive structure-function relationships for nikC .

How does nikC contribute to bacterial pathogenesis and antibiotic resistance?

The nikC protein plays multifaceted roles in bacterial pathogenesis and antibiotic resistance through both direct and indirect mechanisms:

Pathogenesis Contributions:

  • Nutrient Acquisition During Infection:

    • Facilitates nickel scavenging in nickel-limited host environments

    • Supports urease activity in urease-positive pathogens, enabling acid tolerance

    • Enables [NiFe]-hydrogenase function for alternative energy harvesting during infection

  • Biofilm Formation:

    • Nickel transport supports production of nickel-dependent enzymes involved in exopolysaccharide synthesis

    • Contributes to proper maturation of biofilm-associated adhesins

    • Influences quorum sensing systems through metabolic effects

  • Virulence Factor Expression:

    • Affects metal-responsive transcriptional regulators controlling virulence genes

    • Influences oxidative stress responses during host-pathogen interactions

    • Modulates toxin production in response to nickel availability

Antibiotic Resistance Mechanisms:

  • Direct Resistance Contributions:

    • Facilitates efflux of certain antibiotics that form complexes with nickel ions

    • Influences membrane potential through secondary effects on ion homeostasis

    • Contributes to persister cell formation under specific stress conditions

  • Indirect Resistance Effects:

    • Supports metabolic adaptations that reduce antibiotic susceptibility

    • Enables alternative respiratory pathways during antibiotic challenge

    • Contributes to stress response systems that upregulate resistance determinants

Clinical Relevance Data:

PathogennikC ContributionClinical Significance
Uropathogenic E. coliSupports anaerobic respiration in urinary tractAssociated with recurrent UTI persistence
Helicobacter pyloriEssential for urease-mediated acid toleranceRequired for gastric colonization
Salmonella entericaFacilitates intracellular survival in macrophagesContributes to systemic infection capability

Therapeutic Implications:

  • nikC inhibitors represent potential narrow-spectrum antimicrobials for certain pathogens

  • Combination therapies targeting nikC function may potentiate existing antibiotics

  • Monitoring nikC polymorphisms could provide insights into emerging resistance patterns

Experimental evidence suggests that nikC mutations can modulate antibiotic susceptibility by 2-8 fold for certain antibiotic classes, particularly those affected by membrane potential or requiring active transport for cellular entry .

What emerging technologies could advance our understanding of nikC function?

Several cutting-edge technologies show particular promise for advancing nikC research:

Advanced Structural Biology Approaches:

  • Time-Resolved Cryo-EM:

    • Captures transient conformational states during the transport cycle

    • Millisecond-scale temporal resolution reveals intermediate structures

    • Computational sorting of particle images identifies rare conformations

  • Integrative Structural Biology:

    • Combines cryo-EM, X-ray crystallography, and NMR spectroscopy data

    • Cross-links mass spectrometry to identify interaction interfaces

    • Computational modeling fills structural gaps from experimental data

  • In-cell Structural Biology:

    • Electron tomography of intact cells captures native membrane environment

    • In-cell NMR provides dynamic information under physiological conditions

    • Correlative light and electron microscopy connects structure with function

Functional Characterization Technologies:

  • Single-Molecule Approaches:

    • Fluorescence resonance energy transfer (FRET) to track conformational changes

    • Patch-clamp electrophysiology with reconstituted transporters

    • Atomic force microscopy to measure mechanical properties during transport

  • Real-time Transport Visualization:

    • Nickel-sensitive fluorescent probes with subcellular resolution

    • Microfluidic platforms for controlled environmental perturbations

    • Label-free methods such as surface plasmon resonance imaging

Genetic and Genomic Technologies:

  • CRISPR-Based Approaches:

    • Base editing for precise nikC modifications without selection markers

    • CRISPRi/CRISPRa for tunable expression control

    • Perturb-seq for high-throughput functional screening

  • Systems Biology Integration:

    • Multi-omics profiling connecting transport activity to global cellular responses

    • Computational models predicting emergent properties from component interactions

    • Machine learning approaches identifying subtle phenotypic signatures

Emerging Application Areas:

TechnologyKey AdvantageResearch Application
Nanobody developmentStabilizes specific conformational statesCapturing transient intermediates
Deep mutational scanningComprehensive functional landscapeIdentifying subtle structure-function relationships
Synthetic biology circuitsControllable expression systemsDissecting regulatory networks
Microfluidic evolutionDirected evolution under defined gradientsAdapting transport properties to specific conditions

The integration of these technologies through collaborative research initiatives promises to provide unprecedented insights into the structural dynamics, regulation, and functional significance of nikC in diverse bacterial physiological contexts .

How might computational modeling advance nikC research beyond current experimental limitations?

Computational modeling offers powerful approaches to overcome current experimental limitations in nikC research:

Molecular Dynamics (MD) Simulations:

  • Atomistic Transport Mechanism Elucidation:

    • Enhanced sampling techniques reveal complete transport pathways

    • Free energy calculations quantify energetic barriers during ion translocation

    • Identification of water molecules and their roles in ion coordination

  • Membrane Environment Effects:

    • Simulations with diverse lipid compositions reflect different bacterial membranes

    • Investigation of lipid-protein interactions influencing transporter function

    • Exploration of membrane curvature effects on transport dynamics

  • Conformational Ensemble Characterization:

    • Markov state modeling to identify metastable conformational states

    • Transition path theory to map energy landscapes between states

    • Correlation of conformational changes with functional transport steps

Systems-Level Modeling:

  • Multi-scale Integration Approaches:

    • Bridging atomistic simulations with cellular-level models

    • Incorporating transport kinetics into genome-scale metabolic models

    • Predicting emergent behaviors from molecular-level parameters

  • Regulatory Network Analysis:

    • Boolean network models of nickel-responsive regulatory systems

    • Sensitivity analysis identifying key control points in transport regulation

    • Simulation of adaptation to changing environmental nickel availability

Predictive Applications:

  • Rational Design Guidance:

    • In silico mutagenesis predicting functional outcomes

    • Virtual screening for potential transport modulators

    • Computational design of nikC variants with altered specificity or efficiency

  • Experimental Planning Optimization:

    • Identification of high-information-value experiments

    • Bayesian experimental design for efficient hypothesis testing

    • Model-based interpretation of complex experimental results

Computational Resource Requirements:

Modeling ApproachTypical Simulation ScaleComputational Requirements
Atomistic MD100-500 ns trajectories~10,000-50,000 CPU hours
Coarse-grained MD1-10 μs trajectories~5,000-20,000 CPU hours
Quantum mechanics/molecular mechanicsActive site energetics~50,000-100,000 CPU hours
Genome-scale metabolic modelingCellular phenotype prediction~100-1,000 CPU hours

These computational approaches are particularly valuable for addressing questions that are experimentally challenging, such as probing transient states during transport, predicting the effects of mutations in transmembrane regions, and understanding how local conformational changes propagate to affect global transport function. The NIKC database framework provides an ideal platform for integrating these computational results with experimental data for comprehensive analysis .

What potential biotechnological applications might emerge from advanced nikC research?

Advanced research on nikC is poised to enable various innovative biotechnological applications:

Environmental Biotechnology:

  • Enhanced Bioremediation Systems:

    • Engineered E. coli with optimized nikC for nickel hyperaccumulation from contaminated soils and water

    • Dual-function systems combining nickel uptake with biotransformation of organic pollutants

    • Biosensor-modulated expression systems that adjust uptake rates to environmental concentrations

  • Biosensing Technologies:

    • Whole-cell biosensors using nikC-regulated reporter systems for environmental monitoring

    • Field-deployable kits for rapid assessment of bioavailable nickel in environmental samples

    • Integration with microfluidic platforms for continuous monitoring applications

Industrial Biotechnology:

  • Biocatalysis Applications:

    • Enhanced production of nickel-dependent enzymes for industrial catalysis

    • Whole-cell biocatalysts with improved nickel cofactor loading efficiency

    • Controlled delivery of nickel to subcellular enzyme production compartments

  • Biomining Technologies:

    • Selective nickel extraction from low-grade ores using engineered bacteria

    • Biofilm-based recovery systems with enhanced metal accumulation properties

    • Integrated bioprocessing combining leaching, transport, and recovery

Biomedical Applications:

  • Targeted Antimicrobial Approaches:

    • Inhibitors of nikC as narrow-spectrum antimicrobials against specific pathogens

    • Trojan horse conjugates utilizing nikC transport for antibiotic delivery

    • Disruption of bacterial nickel homeostasis to potentiate existing antibiotics

  • Vaccine Development:

    • Attenuated vaccine strains with modified nikC function for controlled growth restriction

    • Antigen delivery systems utilizing nikC regulation for controlled expression

    • Immunomodulatory effects through altered bacterial metabolism

Synthetic Biology Platforms:

ApplicationnikC ModificationExpected Performance
Nickel bioaccumulationChannel-optimized variants5-10× higher nickel recovery
BiocatalysisExpression-optimized systems3-4× improved enzyme activity
BiosensingAffinity-tuned variantsDetection limits of 0.1-1 nM
Antimicrobial targetingTransport-dependent delivery2-3× increased specificity

The commercial development of these applications will require addressing challenges in system stability, regulatory approval, and scale-up production. Collaborative efforts between academic researchers and biotechnology companies are already exploring prototypes for the most promising applications, particularly in environmental remediation and biosensing fields .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.