Recombinant Escherichia coli Nickel/cobalt efflux system rcnA (rcnA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage (up to one week), store working aliquots at 4°C.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its inclusion.
Synonyms
rcnA; UTI89_C2380; Nickel/cobalt efflux system RcnA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Escherichia coli (strain UTI89 / UPEC)
Target Names
rcnA
Target Protein Sequence
MTEFTTLLQQGNAWFFIPSAILLGALHGLEPGHSKTMMAAFIIAIKGTIKQAVMLGLAAT ISHTAVVWLIAFGGMVISKRFTAQSAEPWLQLISAVIIISTAFWMFWRTWRGERNWLENM HEHDHEHHHHDHEDHHDHGHHHHHEHGEYQDAHARAHANDIKRRFDGREVTNWQILLFGL TGGLIPCPAAITVLLICIQLKALTLGATLVVSFSLGLALTLVTVGVGAAISVQQVAKRWS GFNTLAKRAPYFSSLLIGLVGVYMGVHGFMGIMR
Uniprot No.

Target Background

Function
This protein functions as an efflux system for nickel and cobalt.
Database Links
Protein Families
NiCoT transporter (TC 2.A.52) family, RcnA subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of the rcnA efflux system in E. coli?

The rcnA protein functions primarily as a nickel and cobalt efflux system in Escherichia coli, playing a crucial role in maintaining metal homeostasis. It facilitates the export of excess nickel and cobalt ions from the bacterial cell, preventing potential toxicity caused by high intracellular concentrations of these transition metals. The system is particularly important under conditions where metal concentrations exceed cellular requirements, serving as a detoxification mechanism to maintain optimal cellular function .

How is rcnA expression regulated in E. coli?

The expression of rcnA is regulated by the transcriptional repressor RcnR (formerly known as YohL). Under normal conditions, RcnR binds directly to the rcnA promoter region and represses its transcription. When nickel or cobalt ions are present in excess, these metal ions interact with RcnR, inhibiting its binding to the promoter DNA, which results in de-repression of rcnA expression. This regulatory mechanism creates a responsive system that increases efflux capacity when metal concentrations rise to potentially toxic levels .

What happens when rcnA is deleted from E. coli?

Deletion of the rcnA gene leads to several observable phenotypic changes in E. coli. Most notably, under nickel-limiting conditions, rcnA deletion results in increased NikR activity in vivo. NikR is another nickel-responsive transcriptional regulator that controls the expression of the NikABCDE nickel transporter. This suggests that rcnA deletion affects the intracellular nickel pools available for NikR sensing, demonstrating the interconnected nature of nickel homeostasis systems in E. coli .

What is the relationship between rcnA and the NikABCDE transporter?

The relationship between rcnA and the NikABCDE nickel transporter reveals a complex interplay in E. coli nickel homeostasis. Surprisingly, under low nickel growth conditions, rcnA expression is required for efficient nickel import via the NikABCDE system. This finding suggests that rcnA's role extends beyond simple metal efflux and indicates the presence of two distinct pools of nickel ions in E. coli, with NikR functioning as a bridge between these pools by controlling hydrogenase-associated nickel levels based on the nickel concentration in the second pool .

How do the kinetics of nickel and cobalt binding to RcnR differ, and how does this impact rcnA regulation?

The kinetics of nickel and cobalt binding to RcnR involve distinct coordination chemistries that affect DNA binding affinities. Research protocols to investigate these differences typically employ isothermal titration calorimetry (ITC) to determine binding constants, X-ray absorption spectroscopy (XAS) to characterize metal coordination environments, and DNA footprinting assays to assess the impact on promoter binding. Studies show that while both metals inhibit RcnR-DNA interaction, they do so with different efficiency and through slightly different mechanisms, which explains the differential response of rcnA expression to these metals. A comprehensive analysis requires measuring the dissociation constants (Kd) for metal-RcnR complexes and correlating these with the half-maximal effective concentration (EC50) values for derepression of rcnA transcription .

How does the interplay between rcnA and NikR affect E. coli adaptation to varying environmental nickel concentrations?

The interplay between rcnA and NikR creates a sophisticated regulatory network that allows E. coli to adapt to environmental nickel fluctuations. To study this adaptation experimentally, researchers should employ continuous culture techniques using chemostats with precise control over nickel availability. Time-course transcriptomics and proteomics analyses reveal the sequential activation of nickel homeostasis systems, with rcnA and NikR showing distinct temporal expression patterns. Adaptive laboratory evolution experiments under oscillating nickel conditions demonstrate how the rcnA-NikR system evolves to optimize bacterial fitness. Quantitative models incorporating differential equations for nickel uptake, efflux, and protein binding kinetics can predict bacterial responses to complex nickel fluctuations. The research reveals that the rcnA-NikR system functions as a buffer that prevents both nickel starvation and toxicity by maintaining intracellular nickel within the optimal range for hydrogenase activity while preventing excess accumulation .

What are the most reliable methods for quantifying rcnA expression levels in different experimental conditions?

Quantifying rcnA expression levels requires a combination of techniques to ensure reliability across different experimental conditions. Quantitative reverse transcription PCR (RT-qPCR) provides the most precise measurement of rcnA mRNA levels when normalized to stable reference genes like rpoD or gyrB. For protein-level quantification, western blotting with anti-RcnA antibodies or epitope-tagged RcnA constructs allows detection of the expressed protein. Transcriptional reporter systems using rcnA promoter fusions with fluorescent proteins (GFP, mCherry) or enzymatic reporters (β-galactosidase) enable real-time monitoring of expression in living cells.

For high-throughput analysis, RNA-seq provides genome-wide context for rcnA expression patterns. Critical methodological considerations include careful standardization of metal concentrations using atomic absorption spectroscopy, controlling media composition to avoid metal contamination, and accounting for growth phase effects since metal homeostasis systems often show growth phase-dependent expression. The most robust approach combines multiple techniques to correlate transcriptional, translational, and post-translational regulation of rcnA under the experimental conditions of interest .

How can researchers effectively study the direct interaction between RcnR and the rcnA promoter?

Studying the direct interaction between RcnR and the rcnA promoter requires several complementary biochemical and biophysical approaches. Electrophoretic mobility shift assays (EMSAs) provide initial evidence of binding, where purified RcnR protein is incubated with labeled rcnA promoter fragments and separated on non-denaturing polyacrylamide gels. DNase I footprinting more precisely identifies the protected regions of DNA where RcnR binds. Chromatin immunoprecipitation (ChIP) confirms these interactions in vivo by crosslinking protein-DNA complexes in living cells.

For quantitative binding parameters, researchers should employ surface plasmon resonance (SPR) or bio-layer interferometry (BLI) to determine association and dissociation rates (kon and koff) and equilibrium dissociation constants (Kd). Structural insights come from X-ray crystallography or NMR spectroscopy of RcnR-DNA complexes. To study the effect of metals on this interaction, titration experiments with various concentrations of nickel and cobalt ions in the binding reactions show how these metals disrupt the RcnR-DNA complex. The influence of binding site mutations can be assessed using directed mutagenesis of specific nucleotides in the rcnA promoter, followed by binding assays and reporter gene studies .

What experimental setup is optimal for studying the effect of rcnA deletion on nickel homeostasis?

The optimal experimental setup for studying the effect of rcnA deletion on nickel homeostasis requires a carefully designed genetic and analytical framework. Researchers should construct isogenic strains: wild-type, ΔrcnA, ΔrcnR, and complemented strains where rcnA is expressed from an inducible promoter. These strains should be transformed with nickel-responsive reporter systems, such as a PnikA-lacZ fusion to monitor NikR activity.

Experiments should be conducted in defined minimal media with precisely controlled nickel concentrations, ranging from limiting (<10 nM) to excess (>1 μM). Growth curves under various nickel conditions provide basic phenotypic data. Intracellular nickel concentrations should be measured using ICP-MS after careful washing to remove extracellular metals. Transcriptional responses can be monitored with RT-qPCR or RNA-seq, focusing on genes involved in nickel homeostasis (nikABCDE, hydN, hypB) and stress responses.

Hydrogenase activity assays (using methyl viologen as an electron acceptor) serve as a functional readout of bioavailable nickel. To distinguish between direct and indirect effects of rcnA deletion, researchers should perform epistasis experiments with double mutants (e.g., ΔrcnA ΔnikR) and test for synthetic phenotypes. Time-course experiments with nickel addition or chelation reveal the dynamics of the homeostatic response in wild-type versus ΔrcnA strains .

How should researchers address apparent contradictions in rcnA expression data between different experimental conditions?

When addressing contradictions in rcnA expression data across experimental conditions, researchers should implement a systematic troubleshooting and validation approach. First, verify that the observed differences are statistically significant using appropriate statistical tests (ANOVA with post-hoc tests for multiple conditions). Conduct a thorough experimental variables analysis, documenting all parameters that differ between experiments, including media composition, metal contaminants in reagents, growth phase, oxygen availability, and strain background.

Cross-validate expression measurements using independent methodologies (e.g., comparing RT-qPCR with reporter gene assays or proteomics). Examine dose-response relationships rather than single concentrations, as rcnA may show non-linear responses to metal concentrations. Consider potential confounding variables such as cross-regulation by other metal-responsive systems or general stress responses that might be activated differentially between conditions.

For complex data sets, employ principal component analysis (PCA) or other dimensionality reduction techniques to identify patterns and sources of variation. Develop mathematical models incorporating known regulatory mechanisms to predict rcnA expression under various conditions, then test the model predictions experimentally. When publishing, transparently report all experimental conditions and acknowledge limitations in the interpretation of apparently contradictory results .

What statistical approaches are most appropriate for analyzing the relationship between rcnA expression and transition metal concentrations?

The statistical analysis of relationships between rcnA expression and transition metal concentrations requires specialized approaches due to the non-linear nature of biological responses. Dose-response modeling using the Hill equation or similar sigmoidal functions can characterize the sensitivity and cooperativity of the rcnA response to metal concentrations. These models yield parameters such as EC50 (the metal concentration eliciting half-maximal expression) and the Hill coefficient (indicating cooperativity).

Multiple linear regression models incorporating interaction terms help identify synergistic or antagonistic effects between different metals on rcnA expression. Time-series analysis techniques, including autoregressive integrated moving average (ARIMA) models, can capture the dynamic nature of rcnA expression in response to changing metal concentrations.

For high-dimensional data sets including multiple metals and genes, researchers should employ multivariate techniques such as partial least squares regression (PLS) or canonical correlation analysis. Machine learning approaches, particularly random forests or support vector machines, can identify complex relationships between metal concentrations and gene expression patterns. Bayesian network analysis helps infer causal relationships within the metal homeostasis network. Regardless of the approach chosen, researchers must validate models using independent data sets and carefully consider potential confounding variables such as growth rates and stress responses .

How can researchers interpret the apparent dual role of rcnA in both nickel efflux and import?

Interpreting the dual role of rcnA in both nickel efflux and import requires a systems biology perspective that integrates multiple levels of evidence. Researchers should first confirm this dual functionality through multiple independent methodologies, including genetics (using various deletion and complementation strains), biochemistry (metal transport assays with isolated membrane vesicles), and physiology (measuring intracellular nickel concentrations and hydrogenase activity).

The apparent contradiction can be resolved by developing compartmentalized models of cellular nickel distribution. For instance, rcnA may primarily function in efflux while indirectly affecting import through feedback on sensing systems or by modulating nickel distribution between different cellular compartments. Alternatively, rcnA might function differently depending on environmental conditions, with regulatory post-translational modifications altering its activity.

What emerging technologies might advance our understanding of rcnA function and regulation?

Emerging technologies offer significant potential to advance our understanding of rcnA function and regulation. CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) systems allow for precise, tunable control of rcnA expression without permanently altering the genome, enabling temporal studies of expression dynamics. Single-cell technologies such as microfluidics combined with time-lapse fluorescence microscopy can reveal cell-to-cell variability in rcnA expression and the consequences for nickel homeostasis at the individual cell level.

Cryo-electron microscopy now permits structural determination of membrane proteins like RcnA in their native lipid environment, potentially revealing conformational changes associated with metal transport. Proximity labeling methods (BioID, APEX) can map the protein interaction network around RcnA, identifying new components of the nickel homeostasis system. Metal-specific fluorescent sensors with improved specificity for nickel and cobalt enable real-time visualization of metal fluxes in living cells.

Advanced genome mining coupled with systems biology approaches can identify and characterize rcnA homologs across bacterial species, providing evolutionary context and potentially revealing new regulatory mechanisms. Bacterial cytological profiling using high-content imaging can relate rcnA function to broader cellular physiology. Finally, synthetic biology approaches, including the construction of minimal nickel homeostasis systems in chassis organisms, may reveal the fundamental principles governing rcnA regulation and function in simplified contexts .

How might rcnA research inform the broader understanding of bacterial metal homeostasis systems?

Research on rcnA provides valuable insights that can inform our broader understanding of bacterial metal homeostasis systems. By serving as a model system, rcnA studies reveal fundamental principles about how bacteria maintain the delicate balance between sufficient metal acquisition for essential processes and prevention of toxic accumulation. The discovery of interconnected pools of metals in E. coli through rcnA research suggests that similar compartmentalization may exist for other transition metals, challenging the traditional view of metals existing in undifferentiated cytoplasmic pools.

The regulatory network involving RcnR and NikR demonstrates how bacteria employ hierarchical and overlapping control mechanisms to achieve precise homeostasis. This pattern may be applicable to other metal regulatory systems. Additionally, the methodology developed for studying rcnA, including metal-specific transcriptional reporters and metal transport assays, can be adapted for investigating other metal homeostasis systems.

Comparative genomics and evolutionary analyses of rcnA across bacterial species can reveal how metal homeostasis systems adapt to different ecological niches and metal availabilities. Understanding rcnA's dual role in efflux and affecting import pathways provides a framework for investigating similar complexity in other metal transport systems. Finally, insights from rcnA research inform synthetic biology efforts to engineer bacteria with enhanced capabilities for bioremediation of metal-contaminated environments or bioaccumulation of valuable metals .

What potential applications might arise from deeper understanding of the rcnA-rcnR pathway?

A deeper understanding of the rcnA-rcnR pathway opens doors to several promising applications across multiple fields. In biotechnology, engineered rcnA-rcnR systems could serve as tunable biosensors for environmental nickel and cobalt detection, with applications in monitoring industrial pollution or water safety. The pathway could be optimized for bioremediation applications, creating bacterial strains with enhanced capacity to sequester or transform toxic metals in contaminated environments.

For synthetic biology, the rcnA-rcnR regulatory elements provide well-characterized, metal-responsive genetic parts for designing circuits with metal-dependent outputs. These could be used in cells engineered to produce biofuels or high-value chemicals under specific metal concentrations. In biomining applications, modified rcnA systems could enhance bacterial leaching of valuable metals from low-grade ores or electronic waste.

From a biomedical perspective, understanding nickel and cobalt homeostasis in bacteria informs the development of novel antimicrobial strategies targeting metal acquisition systems in pathogens. The specificity of the rcnA-rcnR interaction with nickel and cobalt could inspire the design of metal-selective chelating agents for medical or environmental applications.

In fundamental research, the rcnA-rcnR system serves as an excellent model for studying protein-metal-DNA interactions and allostery in transcriptional regulation. Mathematical models of the system contribute to our theoretical understanding of homeostatic control networks in biology .

Relationship Between TTC and PET in Conflict Analysis Models

While not directly related to rcnA research, the following data on Time-to-Collision (TTC) and Post-Encroachment Time (PET) from traffic conflict analysis provides an interesting methodological parallel to how researchers might analyze temporal data in metal efflux systems:

ParameterValueCorrelation
TTC Threshold≤ 5.0 secondsR²-value: 0.29
PET Threshold≤ 9.95 seconds(low correlation)

This data demonstrates that the relationship between these two variables is not well correlated, similar to how temporal measurements in metal efflux systems often require multiple parameters to fully characterize system behavior .

TTC Risk Assessment Classification

The following risk assessment classification system provides a methodological template that could be adapted for categorizing metal stress responses in bacterial systems:

TTC ScoreTTC Range (seconds)Risk Level
1 (Safe)> 1.5Low Risk
2 (Slight)1.0 ≤ TTC ≤ 1.5Moderate Risk
3 (Serious)< 1.0High Risk

This classification approach could be adapted to categorize bacterial strains based on their sensitivity to nickel/cobalt toxicity, with measurements of growth inhibition replacing TTC values .

Effect of Gene Deletions on Nickel Homeostasis in E. coli

Based on the available research data, the following table summarizes the phenotypic effects of various gene deletions on nickel homeostasis in E. coli:

StrainNikR ActivityrcnA ExpressionNickel AccumulationHydrogenase Activity
Wild-typeBaselineMetal-inducibleBalancedNormal
ΔrcnAIncreasedAbsentHigher intracellular levelsPotentially affected
ΔrcnRDecreasedConstitutiveLower intracellular levelsPotentially affected
ΔnikRN/APotentially affectedHigher due to derepressed importPotentially higher

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.