Recombinant Escherichia coli Nitrate/nitrite sensor protein narX (narX)

Shipped with Ice Packs
In Stock

Description

Introduction

The NarX protein, a histidine kinase receptor, plays a crucial role in the regulation of anaerobic respiration in various bacteria by responding to nitrate and nitrite . In Escherichia coli, NarX, along with NarQ, constitutes a two-component regulatory system that modulates the expression of anaerobic respiratory genes in response to nitrate and nitrite . These sensor-transmitter proteins detect the presence of nitrate in the cell environment and transmit this signal to the response regulator, NarL . Upon activation, NarL binds to DNA and modulates the expression of its target genes through repression or activation of transcription .

Regulatory and Catalytic Domains

  • Regulatory Domain The periplasmic and transmembrane regions of NarX are involved in signal recognition . Removal of the regulatory domain results in a constitutive or "locked-on" kinase .

  • Catalytic Domain The cytoplasmic region of NarX contains the ATP-dependent autokinase activity .

Autophosphorylation and Dephosphorylation

NarX autophosphorylates in response to nitrate and other signals . The kinetic values for autophosphorylation and dephosphorylation are shown in Table 1 .

Table 1: Kinetic Values for Autophosphorylation and Dephosphorylation

ProteinKinetic value bReference
AutophosphorylationDephosphorylation
K<sub>m</sub> ATP (μM)k (10<sup>-4</sup>) (s<sup>-1</sup>)
MBP-NarX 185 a2.4 ± 0.70.5 ± 0.2
MBP-NarQ 182 a22.8 ± 9.32.2 ± 1.1
CheA300 ± 75260 ± 40
NR II (NtrB)31 ± 1.4118 ± 2.5
KinA74 ± 1119 ± 5
EnvZ2180.81 c
PhoQ20.1 ± 13.1− d

Role in Nitrate Regulation

NarX functions independently of NarQ in vivo to activate NarL when nitrate is present and inactivate the NarL protein when no nitrate is available to the cell . These in vivo results align with the documented kinase and phosphatase activities of both NarQ and NarX in vitro .

Mutational Analysis

Mutations in the amino-terminal coding region of NarX can confer an altered signaling phenotype . The amino terminus of the NarX protein is important for the differential response to nitrate and nitrite .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
narX; narR; b1222; JW1213; Nitrate/nitrite sensor protein NarX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
narX
Target Protein Sequence
MLKRCLSPLTLVNQVALIVLLSTAIGLAGMAVSGWLVQGVQGSAHAINKAGSLRMQSYRL LAAVPLSEKDKPLIKEMEQTAFSAELTRAAERDGQLAQLQGLQDYWRNELIPALMRAQNR ETVSADVSQFVAGLDQLVSGFDRTTEMRIETVVLVHRVMAVFMALLLVFTIIWLRARLLQ PWRQLLAMASAVSHRDFTQRANISGRNEMAMLGTALNNMSAELAESYAVLEQRVQEKTAG LEHKNQILSFLWQANRRLHSRAPLCERLSPVLNGLQNLTLLRDIELRVYDTDDEENHQEF TCQPDMTCDDKGCQLCPRGVLPVGDRGTTLKWRLADSHTQYGILLATLPQGRHLSHDQQQ LVDTLVEQLTATLALDRHQERQQQLIVMEERATIARELHDSIAQSLSCMKMQVSCLQMQG DALPESSRELLSQIRNELNASWAQLRELLTTFRLQLTEPGLRPALEASCEEYSAKFGFPV KLDYQLPPRLVPSHQAIHLLQIAREALSNALKHSQASEVVVTVAQNDNQVKLTVQDNGCG VPENAIRSNHYGMIIMRDRAQSLRGDCRVRRRESGGTEVVVTFIPEKTFTDVQGDTHE
Uniprot No.

Target Background

Function

NarX functions as a sensor for nitrate/nitrite, transmitting signals indicating nitrate availability to the NarL protein and both nitrate/nitrite availability to the NarP protein. In the presence of nitrate, NarX likely activates NarL and NarP through phosphorylation. Conversely, NarX may negatively regulate NarL activity through dephosphorylation in the absence of nitrate.

Gene References Into Functions
  1. Bacterial adenylate cyclase two-hybrid analysis revealed strong interactions between NarX-NarL, NarQ-NarL, and NarQ-NarP, but a significantly weaker interaction between NarX-NarP. PMID: 25873583
  2. Missense mutations in NarX impact its phosphatase function without directly altering the active site. PMID: 23517441
  3. The HAMP domain regions HD2 and S-helix overlap, forming a continuous coiled-coil structure characterized by a heptad repeat stutter. Deletions within the conserved S-helix core, particularly those removing the heptad stutter, resulted in impaired induction phenotypes. PMID: 19966007
  4. Analysis of the FNR regulon and its interactions with nitrate, nitrite, NarXL, and NarQP. PMID: 16377617
  5. Studies indicate that only a small fraction of NarX and NarQ remains phosphorylated in the absence of nitrate, leading to efficient dephosphorylation of response regulators by the remaining unphosphorylated sensors. PMID: 18375557
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.