Recombinant Escherichia coli O127:H6 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiA; E2348C_4355; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) using an all-trans polyprenyl group. It mediates the second step in ubiquinone-8 (UQ-8) biosynthesis, specifically the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the initial membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genetic organization of ubiA in the E. coli genome?

The ubiA gene in Escherichia coli is located at approximately minute 79 on the E. coli chromosome map according to genetic analysis studies. The gene encodes 4-hydroxybenzoate octaprenyltransferase, a critical enzyme in the ubiquinone biosynthesis pathway. This chromosomal location has been confirmed through genetic mapping experiments involving ubiquinone-deficient mutants, which have demonstrated consistent linkage relationships with neighboring genetic markers .

What is the biochemical function of 4-hydroxybenzoate octaprenyltransferase in ubiquinone biosynthesis?

4-hydroxybenzoate octaprenyltransferase catalyzes the conversion of 4-hydroxybenzoate into 3-octaprenyl-4-hydroxybenzoate, representing one of the initial steps in ubiquinone (coenzyme Q) biosynthesis. This enzymatic reaction involves the prenylation of 4-hydroxybenzoate with an octaprenyl side chain, forming the basic structural framework for subsequent modifications that ultimately yield the functional ubiquinone molecule. This enzyme plays a pivotal role in establishing the characteristic long isoprenoid side chain that is essential for ubiquinone's function in the respiratory electron transport chain .

How do mutations in ubiA affect bacterial phenotype?

Mutations in the ubiA gene result in ubiquinone-deficient bacterial strains that exhibit characteristic growth deficiencies, particularly under respiratory conditions. Studies have isolated and characterized several ubiA(-) mutants that are unable to convert 4-hydroxybenzoate into 3-octaprenyl-4-hydroxybenzoate. These mutants completely lack 4-hydroxybenzoate octaprenyltransferase activity, confirming that ubiA is indeed the structural gene encoding this enzyme. The resulting ubiquinone deficiency significantly impairs electron transport capabilities, leading to compromised energy production and growth, especially under aerobic conditions where ubiquinone plays a critical role in respiration .

How does the ubiA gene-enzyme relationship fit within the broader ubiquinone biosynthetic pathway?

The ubiA gene encodes 4-hydroxybenzoate octaprenyltransferase, which functions early in the ubiquinone biosynthetic pathway. This pathway involves multiple genes including ubiA, ubiB, ubiE, ubiF, ubiG, and ubiH, each coding for enzymes that catalyze specific steps in the synthesis of ubiquinone. While ubiA catalyzes the prenylation of 4-hydroxybenzoate, other genes like ubiB are involved in monooxygenase steps, ubiE encodes a C-methyltransferase enzyme necessary for both CoQ and menaquinone biosynthesis, and ubiG catalyzes O-methylation steps. The coordinated activity of these enzymes ensures the proper synthesis of functional ubiquinone molecules essential for respiratory electron transport .

What experimental approaches are most effective for characterizing ubiA function?

The most effective experimental approaches for characterizing ubiA function combine genetic manipulation, biochemical assays, and analytical techniques. Genetic approaches involve creating defined ubiA knockout mutants using techniques such as targeted gene disruption, followed by phenotypic characterization and complementation studies. Biochemical assays to measure 4-hydroxybenzoate octaprenyltransferase activity typically involve incubating membrane preparations with radiolabeled substrates (e.g., 14C-labeled 4-hydroxybenzoate) and the prenyl donor, followed by extraction and chromatographic separation of the reaction products. High-performance liquid chromatography (HPLC) is particularly valuable for quantitative analysis of reaction intermediates and products. Additionally, heterologous expression systems can be employed to produce recombinant enzyme for in vitro characterization, though careful consideration must be given to maintaining the integrity of this membrane-associated protein .

How can researchers optimize expression of recombinant ubiA for biochemical studies?

Optimizing expression of recombinant ubiA requires careful consideration of its membrane-bound nature. Effective strategies include:

  • Expression vector selection: Vectors with tunable promoters that allow moderate expression levels often yield higher amounts of functional protein than high-copy, strong promoter systems, which may lead to aggregation of this membrane protein.

  • Host strain selection: E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3), often provide better results than standard laboratory strains.

  • Growth conditions: Lower growth temperatures (16-25°C rather than 37°C) and induction with lower concentrations of inducers can improve the yield of properly folded protein.

  • Membrane extraction: Careful solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin is critical for maintaining enzyme activity.

  • Affinity purification: Implementation of purification tags positioned to minimize interference with membrane insertion and substrate binding is essential for obtaining purified, active enzyme.

Researchers should validate that the recombinant protein retains enzymatic activity by performing activity assays with 4-hydroxybenzoate and prenyl donors in the presence of the required Mg²⁺ cofactor .

What is the relationship between ubiA and the membrane structure in E. coli?

Both 4-hydroxybenzoate octaprenyltransferase (encoded by ubiA) and its prenyl donor substrate are membrane-bound in E. coli. The enzyme is anchored within the bacterial membrane, positioning it optimally for interaction with the hydrophobic prenyl donor substrate. This membrane association is critical for the enzyme's function, as it brings together the water-soluble 4-hydroxybenzoate substrate with the highly hydrophobic prenyl donor.

The membrane microenvironment appears to play a crucial role in facilitating this reaction, potentially by:

  • Providing the proper hydrophobic environment for binding and orienting the prenyl substrate

  • Creating a confined reaction space that increases the effective concentration of substrates

  • Supplying the appropriate physico-chemical conditions for optimal catalytic activity

Studies using membrane preparations have demonstrated that the enzyme requires this native membrane context for maximal activity, although some activity can be retained in properly solubilized forms for in vitro characterization .

How do divalent cations affect 4-hydroxybenzoate octaprenyltransferase activity?

4-hydroxybenzoate octaprenyltransferase requires Mg²⁺ for optimal enzymatic activity. This divalent cation requirement has been established through careful biochemical characterization of the enzyme in membrane preparations. The Mg²⁺ ion likely plays multiple roles in the catalytic mechanism:

  • Coordination of the pyrophosphate moiety of the prenyl donor (octaprenyl pyrophosphate), facilitating its positioning for nucleophilic attack

  • Polarization of the pyrophosphate group, making it a better leaving group

  • Stabilization of the transition state during the prenyl transfer reaction

Researchers studying this enzyme should ensure that their reaction buffers contain appropriate concentrations of Mg²⁺ (typically in the range of 5-10 mM) for optimal activity. Other divalent cations like Mn²⁺ may substitute partially for Mg²⁺ but often with reduced catalytic efficiency .

What are the optimal conditions for assaying 4-hydroxybenzoate octaprenyltransferase activity?

The optimal conditions for assaying 4-hydroxybenzoate octaprenyltransferase activity include:

Buffer Components:

  • pH 7.5-8.0 phosphate or Tris buffer

  • 5-10 mM MgCl₂ (essential cofactor)

  • 0.1-1% appropriate detergent for membrane protein stability (if using purified enzyme)

  • Reducing agent (1-5 mM DTT or β-mercaptoethanol) to maintain thiol groups

Substrate Concentrations:

  • 4-hydroxybenzoate: 50-200 μM

  • Octaprenyl pyrophosphate: 25-100 μM (limiting due to cost and solubility)

Reaction Conditions:

  • Temperature: 30-37°C

  • Time: 15-60 minutes (within linear range)

  • Membrane protein concentration: 0.1-1 mg/ml

Detection Methods:

  • Radiolabeled substrates (¹⁴C-4-hydroxybenzoate) followed by organic extraction and scintillation counting

  • HPLC separation with UV detection at 254-280 nm

  • LC-MS for detailed product characterization

The reaction products should be extracted with appropriate organic solvents (e.g., hexane:isopropanol mixtures) and can be separated from substrates by reversed-phase HPLC. Researchers should include appropriate controls, including heat-inactivated enzyme preparations and samples lacking either substrate, to account for non-enzymatic reactions and background signal .

What genetic tools are available for manipulating ubiA expression in E. coli?

Several genetic tools are available for manipulating ubiA expression in E. coli:

Expression Systems:

  • pET vector series: Allows for controlled, high-level expression under T7 promoter control

  • pBAD vectors: Provides tunable expression levels through arabinose induction

  • pQM vectors: Contains the yeast CYC1 promoter, which has been successfully used for expression of other ubi genes

Mutagenesis Approaches:

  • Site-directed mutagenesis for introducing specific amino acid changes

  • Random mutagenesis coupled with selection for ubiquinone-deficient phenotypes

  • CRISPR-Cas9 systems for precise genomic modifications

Gene Disruption Strategies:

  • Kanamycin resistance cassette insertions (as used in various ubi mutant strains)

  • Lambda Red recombineering for scarless genetic modifications

  • Transposon mutagenesis followed by screening for ubiquinone deficiency

Complementation Testing:

  • Plasmid-based complementation using vectors containing the wild-type ubiA coding region

  • Chromosomal integration of complementing genes

  • Heterologous expression of ubiA homologs from other organisms

When designing genetic constructs, researchers should consider the membrane-bound nature of the enzyme and potentially include appropriate signal sequences or fusion partners to ensure proper membrane targeting and topology .

How can researchers isolate and characterize ubiquinone intermediates from ubiA mutants?

Researchers can isolate and characterize ubiquinone intermediates from ubiA mutants using the following methodologies:

Extraction Procedures:

  • Harvest bacterial cells (typically 50-100 ml culture) in late logarithmic or early stationary phase

  • Extract cells with chloroform:methanol mixtures (2:1 v/v) or hexane:isopropanol mixtures

  • Concentrate organic extracts under nitrogen

  • Purify using solid-phase extraction (SPE) with C18 cartridges (e.g., SepPak)

Fractionation Protocol:

  • Equilibrate SPE cartridge with acetonitrile

  • Apply concentrated extract

  • Elute sequentially with:

    • Acetonitrile

    • Acetonitrile:isopropanol (85:15)

    • Acetonitrile:isopropanol (7:3)

    • Isopropanol

    • Hexane

Analytical Methods:

  • HPLC separation using C18 reversed-phase columns with isocratic or gradient elution (typically using methanol:hexane mixtures as mobile phase)

  • UV detection at 260-290 nm for aromatic intermediates

  • Mass spectrometry for structural confirmation

  • For radioactive tracing experiments, scintillation counting of collected fractions

In ubiA mutants specifically, researchers should focus on detecting accumulated 4-hydroxybenzoate, as these mutants are unable to convert this substrate to 3-octaprenyl-4-hydroxybenzoate. This differs from other ubi mutants (e.g., ubiB mutants) which accumulate later intermediates such as octaprenylphenol (compound 2) .

What are the current limitations in studying 4-hydroxybenzoate octaprenyltransferase structure-function relationships?

Current limitations in studying 4-hydroxybenzoate octaprenyltransferase structure-function relationships include:

Structural Challenges:

  • Difficulty in obtaining high-resolution crystal structures due to the membrane-bound nature of the enzyme

  • Challenges in expressing and purifying sufficient quantities of functional protein

  • Potential conformational heterogeneity affecting structural studies

  • Limited availability of structural data from homologous proteins for comparative modeling

Functional Challenges:

  • Accessing sufficient quantities of the hydrophobic octaprenyl pyrophosphate substrate

  • Developing reliable high-throughput assays for enzymatic activity

  • Difficulties in reconstituting the native membrane environment for in vitro studies

  • Limited understanding of potential protein-protein interactions within the membrane

These limitations might be addressed through emerging approaches such as cryo-electron microscopy for membrane protein structures, nanodiscs or lipid cubic phase technologies for membrane protein crystallization, and computational approaches combining homology modeling with molecular dynamics simulations. Additionally, synthetic biology approaches to engineer simplified variants of the enzyme that retain critical catalytic functions could provide valuable insights into structure-function relationships .

How might advances in membrane protein structural biology contribute to understanding 4-hydroxybenzoate octaprenyltransferase?

Recent advances in membrane protein structural biology offer promising approaches for elucidating the structure and mechanism of 4-hydroxybenzoate octaprenyltransferase:

Emerging Methodologies:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology by eliminating the need for large, well-ordered crystals. Single-particle cryo-EM could potentially resolve the structure of 4-hydroxybenzoate octaprenyltransferase in various functional states.

  • Lipidic cubic phase crystallization: This method provides a more native-like environment for membrane proteins during crystallization trials, potentially improving the chances of obtaining diffraction-quality crystals.

  • Nanodiscs and polymer-based membrane mimetics: These systems can stabilize membrane proteins in solution while maintaining their native conformation and activity, facilitating both structural and functional studies.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can provide information about protein dynamics and solvent accessibility, revealing important mechanistic details about substrate binding and conformational changes.

Potential Structural Insights:

  • Identification of the active site architecture and substrate binding pockets

  • Elucidation of the membrane topology and orientation of catalytic residues

  • Understanding of how the enzyme coordinates binding of both hydrophilic (4-hydroxybenzoate) and hydrophobic (octaprenyl) substrates

  • Visualization of conformational changes during the catalytic cycle

These structural insights would significantly advance our understanding of the catalytic mechanism and potentially inform the design of specific inhibitors or engineered variants with modified activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.