Recombinant Escherichia coli O127:H6 Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance to arrange.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Note: While the tag type is determined during production, please specify your required tag type if needed, and we will prioritize its inclusion.
Synonyms
aas; E2348C_3106; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
aas
Target Protein Sequence
MLFSFFRNLCRVLYRVRVTGDTKALKGERVLITPNHVSFIDGILLALFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVEMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQL KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE
Uniprot No.

Target Background

Function
This bifunctional protein plays a crucial role in lysophospholipid acylation. Specifically, it catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate, requiring ATP and magnesium ions. Its physiological function is to regenerate phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a byproduct of transacylation reactions or phospholipase A1 degradation.
Database Links
Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bifunctional Protein aas and what are its key characteristics?

Bifunctional protein aas (aas) from Escherichia coli O127:H6 is a multifunctional enzyme that plays a crucial role in bacterial phospholipid metabolism. The protein functions primarily as a 2-acylglycerophosphoethanolamine acyltransferase (EC 2.3.1.40) and is also referred to as 2-acyl-GPE acyltransferase . This bifunctionality allows the protein to participate in multiple aspects of membrane lipid homeostasis.

The full-length protein consists of 719 amino acids and has a complex domain structure that supports its multiple catalytic functions . The protein contains regions responsible for substrate binding, catalytic activity, and likely regulatory functions. When expressed recombinantly, it is often produced with an N-terminal histidine tag to facilitate purification using affinity chromatography techniques .

One notable characteristic is the protein's relatively high molecular weight and complex tertiary structure, which presents certain challenges for expression and purification. Its bifunctional nature makes it particularly interesting for researchers studying bacterial metabolism and membrane biology, as it represents an efficient evolutionary solution to performing multiple related catalytic functions within a single polypeptide chain.

How does the bifunctional activity of aas protein contribute to bacterial membrane physiology?

The bifunctional activity of the aas protein plays a central role in bacterial membrane phospholipid remodeling and homeostasis through two interconnected enzymatic functions. As a 2-acylglycerophosphoethanolamine acyltransferase (EC 2.3.1.40), the protein catalyzes the transfer of acyl groups to lysophospholipids, specifically allowing for the reacylation of lysophosphatidylethanolamine to form intact phosphatidylethanolamine . This activity is crucial for maintaining membrane integrity after phospholipid degradation or turnover.

The second function appears to be involved in fatty acid activation or transfer, which complements the acyltransferase activity by ensuring an adequate supply of activated acyl donors. Together, these activities allow bacteria to:

  • Repair damaged membrane phospholipids without complete degradation and resynthesis, conserving energy and resources.

  • Adjust membrane phospholipid composition in response to environmental conditions by incorporating different fatty acids into existing phospholipids.

  • Recycle fatty acids released during phospholipid turnover, contributing to efficient resource utilization.

  • Maintain proper membrane fluidity and barrier function under varying growth conditions.

In the context of E. coli O127:H6, which is an enteropathogenic strain, proper membrane function is essential not only for basic cellular processes but potentially also for pathogenesis. The bifunctional nature of aas represents an elegant evolutionary solution that couples related enzymatic activities, allowing for coordinated regulation and efficient substrate channeling between sequential reactions in phospholipid metabolism.

What expression systems and conditions are optimal for producing recombinant Bifunctional Protein aas?

For optimal expression of recombinant Bifunctional Protein aas, E. coli-based expression systems have proven most effective based on available data. The following methodological approach is recommended:

Expression System Selection:
E. coli is the preferred expression host for this protein, as demonstrated by successful production reported in commercial preparations . This homologous expression system provides the appropriate cellular machinery for proper folding of this bacterial protein.

Vector and Tag Design:

  • Vectors containing strong inducible promoters (T7, tac, or pBAD) allow controlled expression.

  • N-terminal histidine tags (typically 6×His) facilitate purification while minimizing interference with protein function .

  • Constructs should include the full-length sequence (amino acids 1-719) to ensure complete functional integrity .

Expression Conditions:

  • Growth Temperature: Lowering the expression temperature to 16-25°C after induction can improve solubility of this large, multi-domain protein.

  • Induction Parameters: Moderate inducer concentrations (0.1-0.5 mM IPTG for T7-based systems) often yield better results than maximum induction.

  • Growth Media: Rich media such as TB (Terrific Broth) or 2×YT provides resources for high-yield protein production.

  • Expression Duration: Extended expression periods (16-24 hours) at lower temperatures often yield more soluble protein than short, high-intensity expressions.

Strain Selection:
E. coli BL21(DE3) derivatives are commonly used for expression of this protein, as they lack certain proteases and provide the T7 RNA polymerase necessary for T7 promoter-based expression systems .

A systematic optimization approach testing multiple conditions in parallel is recommended to determine the precise parameters that yield maximum soluble protein for specific research applications.

What purification strategies yield highest purity and activity for Bifunctional Protein aas?

Purifying Bifunctional Protein aas to high homogeneity while maintaining enzymatic activity requires a multi-step approach that balances efficient separation from contaminants with preservation of protein structure and function.

Initial Capture: Immobilized Metal Affinity Chromatography (IMAC)

For His-tagged recombinant Bifunctional Protein aas, IMAC provides an effective initial purification step:

  • Equilibrate Ni-NTA or similar resin with a Tris-based buffer (pH 8.0)

  • Apply cleared lysate (typically prepared with mild detergents to solubilize membrane-associated protein)

  • Wash extensively with low imidazole (20-40 mM) to remove weakly bound contaminants

  • Elute with 250-300 mM imidazole gradient or step elution

Intermediate Purification: Ion Exchange Chromatography

Based on the protein's theoretical pI and charge distribution:

  • Anion exchange (Q-Sepharose or equivalent) at pH 7.5-8.0 efficiently separates the protein from remaining contaminants

  • A shallow gradient elution (50-500 mM NaCl) helps resolve closely related species

Polishing Step: Size Exclusion Chromatography

To achieve >90% purity as specified in commercial preparations :

  • Superdex 200 or similar matrix separates monomeric protein from aggregates and smaller contaminants

  • Buffer containing 50 mM Tris pH 8.0, 150 mM NaCl provides stability during separation

Buffer Optimization for Activity Preservation

Throughout purification, maintaining these conditions helps preserve enzymatic activity:

  • Include 5-10% glycerol in all buffers to stabilize protein structure

  • Add reducing agents (1-2 mM DTT or 5 mM β-mercaptoethanol) to protect cysteine residues

  • Maintain temperature at 4°C throughout the process

  • Consider adding enzyme-specific stabilizers based on functional assays

Final Preparation and Storage

For optimal stability:

  • Concentrate to 0.1-1.0 mg/mL using appropriate molecular weight cutoff filters

  • Exchange into final storage buffer containing 50% glycerol and Tris/PBS base

  • Flash-freeze aliquots and store at -80°C to minimize freeze-thaw cycles

This purification strategy typically yields protein with >90% purity as determined by SDS-PAGE, suitable for enzymatic and structural studies .

What analytical methods are most effective for characterizing the dual functions of Bifunctional Protein aas?

Comprehensive characterization of Bifunctional Protein aas requires analytical approaches that can independently assess each of its enzymatic activities while also examining their potential coordination. The following methodological framework is recommended:

Acyltransferase Activity Assays:

  • Radiochemical Assay:

    • Monitor transfer of [14C]-labeled acyl groups from acyl-CoA to lysophospholipid substrates

    • Quantify product formation after lipid extraction and thin-layer chromatography (TLC) separation

    • Calculate specific activity in nmol product/min/mg protein

  • HPLC-Based Assay:

    • Detect formation of phosphatidylethanolamine from lysophosphatidylethanolamine and acyl-CoA

    • Employ reverse-phase HPLC with evaporative light scattering detection (ELSD) or mass spectrometry

    • Enables detailed analysis of acyl chain specificity using various acyl-CoA donors

Spectroscopic Methods for Structural Analysis:

  • Circular Dichroism (CD) Spectroscopy:

    • Assess secondary structure composition (α-helices, β-sheets)

    • Monitor thermal stability and conformational changes under different conditions

    • Compare wild-type and mutant proteins to identify critical structural elements

  • Fluorescence Spectroscopy:

    • Utilize intrinsic tryptophan fluorescence to monitor substrate binding and conformational changes

    • Apply fluorescence resonance energy transfer (FRET) to study domain interactions during catalysis

Substrate Specificity Profiling:

  • Lipid Substrate Array:

    • Test activity against panels of different lysophospholipids

    • Determine chain length and saturation preferences

    • Generate comprehensive substrate specificity profiles

  • Competition Assays:

    • Assess relative substrate preferences using mixtures of potential substrates

    • Identify preferred physiological substrates

Kinetic Analysis:

  • Steady-State Kinetics:

    • Determine Km and Vmax for both enzymatic activities

    • Analyze potential cooperative behavior and allosteric regulation

    • Construct kinetic models of bifunctional behavior

  • Pre-Steady-State Kinetics:

    • Employ stopped-flow techniques to resolve rapid steps in catalysis

    • Identify rate-limiting steps in the catalytic cycle

Analytical Ultracentrifugation:

  • Determine oligomeric state and potential equilibrium between forms

  • Assess homogeneity of purified protein preparations

  • Detect substrate-induced changes in quaternary structure

These analytical methods, used in combination, provide a comprehensive picture of the structure-function relationships and catalytic mechanisms of Bifunctional Protein aas, enabling researchers to understand how its dual activities are coordinated in membrane phospholipid metabolism.

How can researchers effectively generate and characterize site-directed mutants of Bifunctional Protein aas?

Rational Design of Mutations:

  • Target Site Selection:

    • Focus on predicted catalytic residues within each functional domain

    • Target conserved motifs identified through multiple sequence alignments

    • Select residues implicated in substrate binding or domain communication

  • Mutation Strategy Matrix:

Mutation TypePurposeExample Targets
Conservative substitutionsTest chemical requirementsSer→Thr, Asp→Glu
Non-conservative substitutionsAbolish specific functionsSer→Ala, Asp→Asn
Cysteine substitutionsIntroduce labels/crosslinksSurface-exposed residues
Domain truncationsTest domain independenceRemove C- or N-terminal regions

Mutagenesis Protocol:

  • PCR-Based Site-Directed Mutagenesis:

    • Design primers with 25-35 nucleotides containing the desired mutation

    • Employ high-fidelity polymerases to minimize secondary mutations

    • Verify mutations by DNA sequencing before expression

  • Expression Screening:

    • Test expression in parallel with wild-type protein under identical conditions

    • Assess solubility and expression levels using small-scale cultures

    • Optimize conditions for mutants that show altered expression characteristics

Functional Characterization:

  • Activity Assays for Both Functions:

    • Compare specific activities of wild-type and mutant proteins

    • Determine kinetic parameters (Km, kcat) for both enzymatic functions

    • Calculate mutation effects on catalytic efficiency (kcat/Km)

  • Domain-Specific Impact Analysis:

ParameterAcyltransferase DomainSecond Functional Domain
Activity% of wild-type% of wild-type
Substrate affinityKm ratiosKm ratios
Catalytic ratekcat comparisonkcat comparison
Substrate specificityProfile changesProfile changes

Structural Impact Assessment:

  • Thermal Stability Analysis:

    • Compare melting temperatures (Tm) using differential scanning fluorimetry

    • Assess unfolding cooperativity to detect domain-specific effects

  • Limited Proteolysis:

    • Compare digestion patterns between wild-type and mutants

    • Identify regions with altered conformational flexibility

  • Spectroscopic Methods:

    • Use circular dichroism to detect secondary structure changes

    • Apply fluorescence spectroscopy to monitor tertiary structure alterations

Learning from bacterial mutagenesis systems like those used for BFP (bundle-forming pilus) proteins in E. coli, researchers should consider employing non-polar mutations that preserve reading frames of downstream genes when working with operonic contexts .

This comprehensive approach enables researchers to dissect the structure-function relationships of Bifunctional Protein aas and understand how its dual activities are coordinated at the molecular level.

What is known about the regulation of aas gene expression in Escherichia coli O127:H6?

The regulation of aas gene expression in Escherichia coli O127:H6 involves multiple layers of control that ensure appropriate levels of Bifunctional Protein aas under different growth conditions and membrane stress situations. While direct information on aas regulation is limited in the provided search results, we can extrapolate from general E. coli regulatory mechanisms and related gene systems:

Transcriptional Regulation:

The aas gene in E. coli O127:H6 is likely regulated by transcription factors responsive to:

  • Membrane stress conditions - activating expression when membrane damage occurs requiring phospholipid repair

  • Fatty acid availability - coordinating expression with fatty acid metabolism

  • Growth phase changes - potentially upregulating during specific growth phases

Drawing parallels from the regulatory mechanisms seen in other membrane-associated proteins in E. coli, such as the bundle-forming pilus (BFP) system, we can infer that aas might be subject to complex regulatory networks . The BFP system demonstrates how bacterial gene clusters encoding functional protein complexes require coordinated regulation for proper assembly and function.

Post-Transcriptional Control:

RNA-based regulatory mechanisms that potentially affect aas expression include:

  • mRNA stability control - influencing transcript half-life

  • Small RNA interactions - potentially modulating translation efficiency

  • Ribosome binding site accessibility - affecting translation initiation rates

Protein-Level Regulation:

Once expressed, Bifunctional Protein aas activity may be regulated through:

  • Allosteric modulation - by metabolites signaling membrane status

  • Protein-protein interactions - potentially forming functional complexes

  • Post-translational modifications - adjusting activity based on cellular conditions

Regulatory Response Table:

ConditionHypothesized Regulatory ResponseFunctional Outcome
Membrane damageIncreased aas expressionEnhanced phospholipid repair capacity
Stationary phasePotential downregulationConservation of resources during limited growth
Altered fatty acid availabilityModulation of expression/activityAdaptation of membrane composition
Temperature stressPotential upregulationMaintenance of membrane fluidity

Understanding these regulatory mechanisms is critical for researchers working with recombinant systems, as native regulatory elements may need to be preserved or replaced with appropriate inducible systems to achieve desired expression patterns. When designing experiments to study aas function, consideration should be given to the growth conditions and environmental factors that might influence its native expression patterns.

How does Bifunctional Protein aas interact with other components of bacterial membrane homeostasis systems?

Bifunctional Protein aas functions within an integrated network of proteins and processes that collectively maintain bacterial membrane homeostasis. Understanding these interactions is crucial for comprehending its physiological role beyond its isolated enzymatic activities.

Protein-Protein Interaction Network:

Bifunctional Protein aas likely participates in multiple protein-protein interactions that coordinate membrane lipid metabolism:

  • Phospholipid Synthesis Enzymes:

    • Direct interactions with enzymes like PssA (phosphatidylserine synthase) and Psd (phosphatidylserine decarboxylase) may coordinate de novo synthesis with remodeling pathways

    • These interactions potentially create efficient substrate channeling between sequential enzymatic reactions

  • Fatty Acid Metabolism Proteins:

    • Association with FadD (fatty acyl-CoA synthetase) could facilitate the coupling of fatty acid activation to phospholipid remodeling

    • Interactions with FabZ (3-hydroxyacyl-ACP dehydratase) and other fatty acid biosynthetic enzymes might coordinate membrane lipid composition

  • Membrane-Associated Complexes:

    • Similar to the organization seen in bundle-forming pilus (BFP) biogenesis, where multiple proteins form functional complexes , aas may participate in larger assemblies

    • These complexes could include proteins involved in phospholipid transport and membrane organization

Functional Integration Table:

SystemInteraction TypeFunctional Significance
Phospholipid synthesisMetabolic couplingBalances de novo synthesis with remodeling
Fatty acid metabolismSubstrate channelingEnsures efficient utilization of fatty acids
Membrane repairSignalingResponds to membrane damage events
Outer membrane biogenesisIndirect regulationMaintains appropriate phospholipid composition

Spatial Organization:

The localization of Bifunctional Protein aas within the bacterial cell influences its interactions:

  • Membrane Association:

    • The N-terminal domain likely mediates membrane association, positioning the enzyme near its substrates

    • This membrane association may create microdomains enriched in lipid remodeling enzymes

  • Dynamic Redistribution:

    • Under stress conditions, aas may redistribute to damaged membrane regions

    • This dynamic localization would allow targeted repair of compromised membrane areas

Metabolic Integration:

Beyond direct protein interactions, aas functions within broader metabolic networks:

  • Response to Phospholipid Turnover:

    • Coordinates with phospholipases that generate lysophospholipid substrates

    • Creates recycling pathways for fatty acids released during membrane remodeling

  • Stress Response Systems:

    • Functions alongside envelope stress response systems like Cpx and σE pathways

    • Contributes to adaptive responses to environmental challenges

This integrated view of Bifunctional Protein aas within bacterial membrane homeostasis systems provides a framework for experimental designs that consider not just the isolated protein but its functional context within the complex bacterial cell envelope maintenance network.

What are common challenges in working with Bifunctional Protein aas and how can they be addressed?

Researchers working with Bifunctional Protein aas frequently encounter several technical challenges that can impede experimental progress. The following comprehensive troubleshooting guide addresses these issues and provides methodological solutions:

Challenge 1: Protein Solubility and Aggregation

Bifunctional Protein aas, with its multiple domains and membrane association tendencies, often presents solubility challenges during expression and purification.

ProblemDiagnostic SignsSolution Strategy
Inclusion body formationLow soluble protein yield; protein in pellet after lysis- Reduce expression temperature to 16-18°C
- Use autoinduction media for gradual protein expression
- Co-express with chaperones (GroEL/GroES system)
- Add solubility enhancers like 0.5% Triton X-100 to lysis buffer
Post-purification aggregationIncreased turbidity; loss of activity over time; precipitation during concentration- Include 5-10% glycerol in all buffers
- Maintain protein at moderate concentrations (0.1-1.0 mg/mL)
- Add mild detergents (0.01-0.05% DDM) to stabilize membrane-associated domains
- Optimize salt concentration (typically 150-300 mM NaCl)

Challenge 2: Activity Loss During Purification

The bifunctional nature of the protein makes it particularly susceptible to activity loss during purification steps.

ProblemDiagnostic SignsSolution Strategy
Oxidative inactivationProgressive activity loss; reversed by reducing agents- Include reducing agents (2 mM DTT or 5 mM β-mercaptoethanol) in all buffers
- Perform all steps under nitrogen or argon atmosphere when possible
- Add metal chelators (0.1 mM EDTA) to remove trace metals causing oxidation
Proteolytic degradationMultiple bands on SDS-PAGE; reduced molecular weight- Add protease inhibitor cocktail during lysis and early purification steps
- Maintain samples at 4°C throughout purification
- Minimize time between purification steps
Cofactor lossReduced specific activity- Supplement buffers with potential cofactors (Mg2+, Mn2+)
- Consider short incubation with substrate analogs to stabilize active conformation

Challenge 3: Inconsistent Activity Assay Results

Measuring the dual activities of the protein reliably presents methodological challenges.

ProblemDiagnostic SignsSolution Strategy
Substrate preparation variabilityHigh day-to-day assay variation- Prepare and validate stock solutions of lipid substrates with defined protocols
- Store lipid substrates under inert gas at -80°C
- Use internal standards for activity normalization
Detergent interferenceConcentration-dependent activity fluctuations- Systematically optimize detergent type and concentration
- Use detergent concentrations well below critical micelle concentration
- Consider detergent-free systems using nanodiscs or liposomes
Coupled assay variabilityIrreproducible results between batches- Increase coupling enzyme concentrations to ensure they're not limiting
- Validate coupling enzyme activity independently before each assay
- Include appropriate controls for background activity

Challenge 4: Storage Stability Issues

Maintaining protein activity during storage is often problematic.

ProblemDiagnostic SignsSolution Strategy
Freeze-thaw damageActivity loss after thawing- Aliquot protein before freezing to avoid repeated freeze-thaw cycles
- Include cryoprotectants (50% glycerol)
- Flash-freeze in liquid nitrogen before transferring to -80°C
Long-term storage degradationProgressive activity loss over weeks/months- Store working aliquots at 4°C for up to one week
- Optimize buffer components for long-term stability
- Consider lyophilization with appropriate excipients for certain applications

By systematically applying these troubleshooting strategies, researchers can overcome the technical challenges associated with Bifunctional Protein aas, enabling more reliable and reproducible experimental outcomes.

How should researchers analyze and interpret kinetic data for the dual enzymatic activities of Bifunctional Protein aas?

Analyzing kinetic data for bifunctional enzymes like aas presents unique challenges requiring specialized approaches to accurately characterize each activity and understand their potential interdependence. The following methodological framework guides researchers through this complex analysis:

Independent Activity Analysis

First, assess each enzymatic function independently using appropriate substrate conditions:

For acyltransferase activity (2-acylglycerophosphoethanolamine acyltransferase, EC 2.3.1.40) :

  • Initial Rate Determination:

    • Measure product formation under conditions where <10% of substrate is consumed

    • Plot initial velocity (v₀) against substrate concentration [S]

    • Fit data to appropriate kinetic models

  • Basic Kinetic Parameter Extraction:

ParameterCalculation MethodInterpretation
VmaxHyperbolic fit to Michaelis-Menten equationMaximum velocity at saturating substrate
KmSubstrate concentration at 0.5VmaxInverse measure of substrate affinity
kcatVmax/[E]totalCatalytic rate constant
kcat/KmRatio calculationCatalytic efficiency
  • Data Visualization Approaches:

    • Direct plots: v vs [S]

    • Double-reciprocal (Lineweaver-Burk) plots: 1/v vs 1/[S]

    • Eadie-Hofstee plots: v vs v/[S]

    • Hanes-Woolf plots: [S]/v vs [S]

Mechanistic Model Testing

Apply more sophisticated kinetic analyses to investigate potential deviations from simple Michaelis-Menten kinetics:

  • Test for Cooperativity:

    • Plot data using Hill equation: v = Vmax[S]^n/(K0.5^n + [S]^n)

    • Calculate Hill coefficient (n) to quantify cooperative behavior

    • n > 1 indicates positive cooperativity; n < 1 indicates negative cooperativity

  • Evaluate Alternative Models:

Kinetic BehaviorMathematical ModelDiagnostic Feature
Substrate inhibitionv = Vmax[S]/(Km + [S] + [S]²/Ki)Activity decrease at high [S]
Product inhibitionv = Vmax[S]/(Km(1 + [P]/Kp) + [S])Determine mode (competitive, uncompetitive, mixed)
Random vs. ordered mechanismBi-substrate kinetics analysisPattern of double-reciprocal plots

Interrelationship Between Activities

Investigate potential coupling between the two enzymatic functions:

  • Activity Modulation Experiments:

    • Test whether substrates/products of one activity affect the other

    • Measure activity correlations across protein variants

    • Perform isotope tracing to track substrate channeling

  • Data Analysis for Functional Coupling:

Analysis ApproachMethodInterpretation
Cross-substrate effectsMeasure activity 1 with varying concentrations of activity 2 substrateIdentifies allosteric regulation
Thermodynamic linkageGlobal fitting of multiple datasetsQuantifies energetic coupling between functions
Statistical correlationCompare activity ratios across conditionsDetects co-regulation of activities

Temperature and pH Dependencies

Analyze the environmental dependencies of each activity to reveal mechanistic insights:

  • Arrhenius Analysis:

    • Plot ln(k) vs 1/T for each activity

    • Calculate activation energies (Ea)

    • Compare temperature optima and thermal stability ranges

  • pH-Activity Profiles:

    • Generate bell-shaped curves for each activity

    • Determine pKa values of catalytically important residues

    • Compare pH optima for potential mechanistic insights

This systematic approach to kinetic data analysis enables researchers to fully characterize the complex behavior of Bifunctional Protein aas, revealing not just the parameters of each activity but also their potential interdependence and regulatory mechanisms.

What strategies can resolve contradictory results when studying Bifunctional Protein aas?

Source 1: Protein Heterogeneity Issues

Contradictory findings often stem from variations in protein preparations that affect activity or behavior.

Contradiction TypeAnalytical ApproachResolution Strategy
Activity variations between preparationsQuantitative SDS-PAGE densitometry
Mass spectrometry integrity analysis
- Standardize protein quantification methods
- Implement activity normalization protocols
- Establish minimum purity criteria (>90%)
- Develop specific activity benchmarks
Inconsistent oligomerization stateAnalytical size exclusion chromatography
Dynamic light scattering
- Characterize all preparation conditions for oligomeric state
- Report oligomeric distribution with functional data
- Isolate and test specific oligomeric forms separately
Post-translational modification differencesLC-MS/MS phosphorylation mapping
Glycosylation profiling
- Document modification status for all preparations
- Compare active vs. inactive preparations for modification patterns
- Generate site-directed mutants at modification sites

Source 2: Methodological Variables

Different experimental approaches can lead to apparently conflicting results that may actually represent complementary information.

Contradiction TypeAnalytical ApproachResolution Strategy
Assay-dependent activity differencesSystematic comparison of assay methods
Correlation analysis between assay types
- Identify assay-specific variables (detergents, coupling enzymes)
- Develop correction factors between assay types
- Create standard reference materials for inter-lab validation
Buffer/condition sensitivitiesDesign of Experiments (DoE) screening
Response surface methodology
- Map activity landscape across multiple buffer variables
- Identify interaction effects between buffer components
- Establish robust condition ranges where activity is stable
Substrate preparation differencesThin-layer chromatography purity analysis
Mass spectrometry characterization
- Standardize substrate preparation protocols
- Validate substrate integrity before each experiment
- Quantify substrate micelle/vesicle properties

Source 3: Data Interpretation Frameworks

Contradiction TypeAnalytical ApproachResolution Strategy
Kinetic model discrepanciesAkaike Information Criterion (AIC) model comparison
Residual analysis of fitted models
- Apply multiple kinetic models to the same dataset
- Use statistical criteria to select best-fit models
- Report parameter confidence intervals rather than point estimates
Structure-function relationship contradictionsMolecular dynamics simulations
Homology model comparison
- Integrate structural and functional data systematically
- Develop testable hypotheses that distinguish between models
- Generate structure-guided mutations to test competing mechanisms
Domain contribution conflictsTruncation analysis
Domain-specific inactivation
- Create comprehensive domain deletion/mutation series
- Measure both activities across all variants
- Map interdomain communication pathways

Resolution Framework Implementation:

When confronted with contradictory results, implement this systematic resolution workflow:

  • Contradiction Characterization:

    • Define precisely what results appear contradictory

    • Identify all variables that differ between contradictory results

    • Quantify the magnitude and reproducibility of contradictions

  • Controlled Variable Testing:

    • Design experiments that isolate single variables

    • Implement internal controls to validate assay performance

    • Use statistical power analysis to ensure adequate replication

  • Data Integration Approaches:

    • Apply meta-analysis techniques to synthesize across studies

    • Develop unifying models that accommodate seemingly contradictory results

    • Consider time-resolved or condition-dependent models that explain different observations

This structured approach transforms contradictions from research obstacles into opportunities for deeper mechanistic understanding of Bifunctional Protein aas function.

How can structural biology techniques advance our understanding of Bifunctional Protein aas?

Advanced structural biology approaches offer powerful tools to elucidate the molecular architecture of Bifunctional Protein aas and provide insights into its dual functionality. The following methodological framework outlines cutting-edge techniques and their specific applications to this complex protein:

X-ray Crystallography Approaches

Despite challenges in crystallizing membrane-associated proteins like aas, several strategies can yield structural insights:

  • Construct Optimization:

    • Design truncation constructs focusing on individual domains

    • Create fusion proteins with crystallization chaperones (T4 lysozyme, BRIL)

    • Engineer surface mutations to reduce conformational heterogeneity

  • Crystallization Strategy:

    • Implement lipid cubic phase (LCP) crystallization for membrane-associated domains

    • Use ligand-bound states to stabilize specific conformations

    • Apply microseed matrix screening to identify novel crystallization conditions

  • Structural Analysis Goals:

    • Determine active site architectures for both enzymatic functions

    • Map substrate binding pockets and specificity determinants

    • Identify interdomain interfaces and potential communication pathways

Cryo-Electron Microscopy (Cryo-EM)

For capturing the complete bifunctional protein and its dynamic states:

  • Sample Preparation Optimization:

    • Reconstitute protein in nanodiscs to maintain native-like membrane environment

    • Prepare samples in multiple functional states (apo, substrate-bound, product-bound)

    • Apply GraFix or crosslinking approaches to reduce conformational heterogeneity

  • Data Collection Strategy:

    • Implement energy-filtered data collection to enhance contrast

    • Use tilted data collection to address preferred orientation issues

    • Apply time-resolved approaches to capture catalytic intermediates

  • Analysis Objectives:

    • Generate 3D reconstructions at sub-4Å resolution

    • Identify conformational ensembles representing catalytic cycle

    • Map domain movements associated with substrate binding and catalysis

Integrative Structural Biology Approaches

Combining multiple techniques for comprehensive structural characterization:

Molecular Dynamics Simulations

Computational approaches to understand dynamic behavior:

  • System Setup:

    • Embed protein in appropriate membrane mimetics

    • Model both enzymatic activities in relevant environments

    • Implement enhanced sampling techniques (metadynamics, umbrella sampling)

  • Simulation Analysis:

    • Identify allosteric communication pathways between domains

    • Map energy landscapes of conformational transitions

    • Characterize substrate binding and product release pathways

Structure-Guided Functional Studies

Translating structural insights into functional understanding:

  • Rational Mutagenesis Design:

    • Target residues in catalytic sites, substrate binding pockets, and domain interfaces

    • Engineer disulfide bonds to trap specific conformational states

    • Create reporter constructs with fluorophores at domain boundaries

  • Activity Correlation Analysis:

    • Map structure-derived mutations to functional effects on both activities

    • Identify structurally coupled residues based on mutation effects

    • Develop structure-based models of bifunctional coordination

This comprehensive structural biology approach will significantly advance our understanding of how Bifunctional Protein aas coordinates its dual enzymatic activities and interacts with membrane environments to maintain bacterial phospholipid homeostasis.

What is the potential role of Bifunctional Protein aas in bacterial pathogenesis and antimicrobial resistance?

The bifunctional protein aas from Escherichia coli O127:H6, an enteropathogenic strain, may play significant roles in bacterial pathogenesis and antimicrobial resistance through its effects on membrane phospholipid homeostasis. Understanding these connections opens new research avenues with potential therapeutic implications.

Membrane Integrity and Pathogenesis

The role of aas in maintaining membrane phospholipid composition may directly impact virulence mechanisms:

  • Host-Pathogen Interface Dynamics:

    • Membrane phospholipid composition affects bacterial adhesion to host cells

    • Similar to how bundle-forming pili (BFP) mediate localized adherence (LA) to host cells , membrane properties influenced by aas may modulate pathogen-host interactions

    • Phospholipid remodeling may be crucial during different infection stages

  • Stress Adaptation During Infection:

    • Infection environments present multiple stresses (pH changes, antimicrobial peptides)

    • aas-mediated phospholipid remodeling may enable adaptation to these stresses

    • Maintaining membrane integrity during host-induced stress could be essential for persistence

  • Virulence Factor Expression and Function:

    • Proper membrane composition is required for numerous virulence-associated membrane proteins

    • In EPEC strains like O127:H6, virulence factors such as the type III secretion system depend on appropriate membrane environments

    • The BFP system in EPEC demonstrates how multiple proteins must function together for virulence , suggesting aas could be part of a larger virulence-associated network

Antimicrobial Resistance Connections

Bifunctional Protein aas may contribute to antimicrobial resistance through several mechanisms:

  • Membrane Permeability Barriers:

    • Phospholipid composition directly affects membrane permeability to antibiotics

    • aas-mediated remodeling could enhance resistance to membrane-active antimicrobials

    • Adaptive responses to antibiotic exposure may involve altered aas activity

  • Membrane Damage Repair:

    • Many antibiotics induce membrane stress or damage

    • aas function in phospholipid repair could counteract antibiotic-induced membrane perturbations

    • Enhanced repair mechanisms may contribute to tolerance of membrane-targeting antibiotics

  • Biofilm Formation and Persistence:

    • Phospholipid composition affects bacterial surface properties relevant to biofilm formation

    • Biofilms provide antibiotic resistance through multiple mechanisms

    • aas activity may support the membrane adaptations required for biofilm lifestyle

Research Approaches to Investigate Pathogenesis and Resistance Roles

Research DirectionMethodological ApproachExpected Insights
Membrane adaptations during infectionLipidomics analysis of bacteria recovered from infection modelsInfection-specific phospholipid remodeling patterns
aas expression patterns during pathogenesisTranscriptomics/proteomics of bacteria during different infection stagesTemporal regulation of aas during host interaction
Impact on specific virulence mechanismsPhenotypic analysis of aas mutants (similar to bfp mutant studies )Virulence mechanisms dependent on aas function
Antibiotic susceptibility profilingMinimum inhibitory concentration (MIC) determination for aas mutants vs. wild-typeClasses of antibiotics affected by aas function
Membrane adaptation to antimicrobialsTime-resolved lipidomics during antibiotic exposureaas-dependent lipid remodeling response to antibiotics

Therapeutic Implications

Understanding aas function in pathogenesis and resistance could lead to novel therapeutic approaches:

  • aas Inhibitor Development:

    • Structure-based design of small molecules targeting aas active sites

    • Potential for dual-action compounds targeting both enzymatic functions

    • Adjuvant therapy to enhance efficacy of existing antibiotics

  • Virulence Attenuation Strategy:

    • Similar to how bfp mutations affect EPEC virulence , targeting aas could reduce pathogenicity

    • Anti-virulence approaches may face reduced selection pressure for resistance

This research direction connects fundamental enzymology to clinical applications, potentially yielding new strategies to combat enteropathogenic E. coli infections and address antimicrobial resistance challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.