Recombinant Escherichia coli O127:H6 Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O127:H6 Cardiolipin Synthase (cls)

Recombinant Escherichia coli O127:H6 Cardiolipin Synthase (cls) is a bioengineered protein derived from the clsA gene of E. coli O127:H6, a pathogenic serotype of enteropathogenic E. coli (EPEC). This enzyme catalyzes the synthesis of cardiolipin (CL), a diphosphatidylglycerol lipid critical for bacterial membrane architecture and function. The recombinant protein is expressed in E. coli with an N-terminal His-tag for purification and is widely used in structural, enzymatic, and membrane biology studies .

Catalytic Function

Cardiolipin synthase (cls) facilitates reversible phosphatidyl group transfer between two phosphatidylglycerol (PG) molecules:
PG+PGCL+glycerol\text{PG} + \text{PG} \leftrightarrow \text{CL} + \text{glycerol}
This reaction is critical for maintaining CL levels, which influence membrane fluidity, protein complex stabilization, and stress resistance .

Regulation and Inhibition

  • Product Inhibition: CL directly inhibits enzyme activity, while phosphatidate (PA) and phosphatidylethanolamine (PE) modulate inhibition .

  • Genetic Regulation: cls expression is tightly controlled to prevent CL overproduction, potentially via feedback mechanisms .

Studies on cls Mutants

StrainPhenotypeKey Findings
Wild-typeNormal growth, CL synthesisCL essential for membrane integrity and stress tolerance
cls null mutantSlower growth, reduced viability in stationary phase, trace CL synthesisCL production persists via alternative pathways (e.g., phosphatidylserine synthase)

Recombinant Protein Utilization

  • SDS-PAGE: Used to validate protein purity (>90%) and confirm posttranslational modifications .

  • ELISA: Recombinant cls is employed as an antigen in immunoassays for detecting anti-cls antibodies or studying protein-protein interactions .

Expression and Handling

  • Expression System: E. coli hosts enable high-yield production; purification involves Ni²⁺ affinity chromatography (His-tag) .

  • Storage: Lyophilized powder stored at -20°C/-80°C; reconstituted in deionized water (0.1–1.0 mg/mL) with 50% glycerol for stability .

Note: Repeated freeze-thaw cycles degrade enzyme activity. Working aliquots are stored at 4°C for ≤1 week .

Functional Insights

  • Membrane Stability: CL deficiency in cls mutants correlates with impaired growth and viability under stress, emphasizing CL’s role in maintaining membrane architecture .

  • Cross-Species Complementation: While not directly tested for E. coli O127:H6 cls, studies in Trypanosoma brucei and yeast suggest conserved CL synthesis mechanisms across eukaryotes and prokaryotes .

Potential Applications

  • Antibiotic Targets: cls inhibitors could disrupt pathogenic E. coli membranes, though CL’s dispensability in E. coli complicates therapeutic targeting .

  • Structural Biology: Recombinant cls enables studies on active site motifs (e.g., RN(Q)HRK and HXK sequences) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; E2348C_1375; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Uniprot No.

Target Background

Function

Function: Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Cardiolipin synthase (cls) and what is its function in Escherichia coli O127:H6?

    Cardiolipin synthase (cls) is a membrane-bound enzyme belonging to the phospholipase D superfamily that catalyzes the formation of cardiolipin (CL), a key phospholipid in bacterial membranes. In E. coli O127:H6, cardiolipin typically constitutes 5-15% of the phospholipid content depending on growth phase and culture conditions, with the remainder primarily being phosphatidylethanolamine (PE) and phosphatidylglycerol (PG) . Cardiolipin plays critical roles in membrane structure, osmotic stress responses, and the proper functioning of membrane proteins, particularly in energy-transducing systems. The enzyme catalyzes condensation reactions that form the characteristic four-acyl chain structure of cardiolipin from precursor phospholipids .

  • How many types of Cardiolipin synthases are present in E. coli and how do they differ?

    E. coli possesses three distinct cardiolipin synthases, each with unique characteristics:

    EnzymeEncoding GeneOriginal Gene NameSubstrate PreferenceExpression Pattern
    ClsAclsAclsTwo PG moleculesAll growth phases
    ClsBclsBybhOTwo PG moleculesPrimarily stationary phase
    ClsCclsCymdCPE and PGRequires YmdB co-expression

    While ClsA and ClsB catalyze the condensation of two phosphatidylglycerol (PG) molecules to form cardiolipin and glycerol, ClsC uniquely utilizes phosphatidylethanolamine (PE) as the phosphatidyl donor to PG, demonstrating a third and distinct mechanism for cardiolipin synthesis . All three enzymes belong to the phospholipase D superfamily but differ in their catalytic efficiency and regulation patterns .

  • What expression systems are recommended for producing recombinant E. coli O127:H6 Cardiolipin synthase?

    For recombinant expression of E. coli O127:H6 Cardiolipin synthase, E. coli itself serves as an effective expression host. The methodological approach typically involves:

    1. Gene amplification from E. coli O127:H6 genomic DNA

    2. Cloning into expression vectors containing appropriate promoters (such as arabinose-inducible pBAD30)

    3. Transformation into expression strains (preferably deficient in endogenous cls genes for functional studies)

    4. Induction with appropriate agents (0.2% arabinose has been successfully used)

    5. Purification using affinity chromatography via N-terminal His-tags

    For functional studies, complementation experiments in ΔclsABC mutants provide valuable insights into activity and substrate specificity . Including ribosome-binding sites in the expression construct ensures efficient translation of the recombinant protein .

Experimental Design and Methodology

  • What methods are most effective for assaying Cardiolipin synthase activity in vitro?

    Effective in vitro assays for Cardiolipin synthase activity incorporate several critical elements:

    1. Substrate preparation: Synthetic phospholipids with defined acyl chain compositions (e.g., PG 12:0/13:0 and PE 14:1/17:0) allow for unambiguous identification of reaction products

    2. Reaction conditions:

      • Buffer composition: Typically Tris or phosphate-based buffers (pH 7.5-8.0)

      • Divalent cations: Mg²⁺ or Mn²⁺ may enhance activity

      • Detergent: Low concentrations to solubilize membrane proteins without denaturing them

      • Temperature: 30-37°C for optimal enzymatic activity

    3. Detection methods:

      • Thin Layer Chromatography (TLC): Provides rapid visualization of cardiolipin formation using charring with sulfuric acid or specific phospholipid stains

      • Mass Spectrometry:

        • LC/MS/MS with multiple reaction monitoring (MRM)

        • Triple quadrupole instruments for selective detection of expected cardiolipin species

        • First mass filter (Q1) selects for expected [M-2H]²⁻ ions

        • MS/MS collision cell fragments the molecules

        • Last mass filter (Q3) isolates specific acyl chain fragments

      • Radioactive assays: Using ³²P-labeled substrates for quantitative analysis of product formation

    The MRM approach with defined synthetic substrates is particularly powerful as it allows unambiguous determination of which phospholipid contributes the phosphatidyl moiety to the final cardiolipin molecule .

  • How can gene knockout studies be designed to investigate the roles of different cls genes?

    Effective gene knockout studies for cls genes require careful experimental design:

    1. Sequential deletion strategy:

      • Individual deletions (ΔclsA, ΔclsB, ΔclsC)

      • Double deletions (ΔclsAB, ΔclsBC, ΔclsAC)

      • Triple deletion (ΔclsABC)

      • Additional knockout of related genes (e.g., ΔymdB)

    2. Validation methods:

      • PCR verification of gene deletions

      • RT-PCR or RNA-seq to confirm absence of transcripts

      • Western blotting to confirm absence of protein expression

    3. Phenotypic analysis:

      • Lipid extraction and comprehensive phospholipid profiling using TLC and mass spectrometry

      • Growth curve analysis under various conditions (different osmolarities, growth phases)

      • Membrane integrity and stress response assays

    4. Complementation experiments:

      • Expression of individual cls genes in various knockout backgrounds

      • Co-expression of functionally related genes (e.g., clsC with ymdB)

      • Expression from native versus artificial promoters

      • Expression of site-directed mutants in catalytic domains

    The ΔclsABC triple mutant shows no detectable cardiolipin regardless of growth phase or conditions, confirming these three enzymes account for all cardiolipin synthesis in E. coli . This systematic approach can reveal the relative contributions and specific roles of each cardiolipin synthase under different physiological conditions.

  • What are the best practices for analyzing cardiolipin by mass spectrometry?

    Mass spectrometry analysis of cardiolipin requires specific considerations due to its unique structure and properties:

    1. Sample preparation:

      • Gentle lipid extraction methods (Bligh and Dyer or Folch procedures)

      • Separation of phospholipid classes by solid phase extraction

      • Minimal exposure to oxidizing conditions

    2. Instrumentation:

      • ESI-MS in negative ion mode (cardiolipin carries negative charges)

      • Triple quadrupole systems for targeted analysis

      • High-resolution instruments (Q-TOF, Orbitrap) for untargeted profiling

    3. Analysis parameters:

      • Detection of doubly charged [M-2H]²⁻ ions (characteristic of cardiolipin)

      • Multiple reaction monitoring (MRM) for acyl chain composition analysis

      • Mass shifts of m/z 9 or 10 to distinguish isotopically labeled species

    4. Data interpretation considerations:

      • Complex cardiolipin spectra due to diversity of acyl chain compositions

      • Potential isobaric species requiring MS/MS for disambiguation

      • Relative quantification using internal standards

    For specific structural confirmation, LC/MS/MS with MRM can isolate expected cardiolipin species (e.g., m/z 618.4 for [M-2H]²⁻) and then monitor product ions corresponding to specific acyl chains (e.g., m/z 225.2 for 14:1 and 269.2 for 17:0) . This approach unambiguously determines which precursor phospholipids contribute to the cardiolipin structure.

Advanced Research Applications

  • How can site-directed mutagenesis be applied to study catalytic mechanisms of Cardiolipin synthase?

    Site-directed mutagenesis provides valuable insights into the catalytic mechanism of Cardiolipin synthase through systematic modification of key residues:

    1. Target selection strategy:

      • HKD catalytic motif residues (His, Lys, Asp) that are highly conserved in the phospholipase D superfamily

      • Residues implicated in substrate binding based on homology modeling

      • Residues at the interface between protein domains

      • Conserved residues identified through multi-sequence alignment

    2. Mutation design considerations:

      • Conservative substitutions (e.g., His→Asn, Asp→Glu) to probe specific chemical properties

      • Non-conservative substitutions (e.g., charged→hydrophobic) for dramatic functional changes

      • Alanine scanning of regions with unknown function

    3. Functional assessment methods:

      • In vivo complementation in ΔclsABC backgrounds

      • In vitro activity assays with purified mutant proteins

      • Substrate binding studies to distinguish catalytic from binding defects

      • Structural analysis of mutant proteins by circular dichroism or thermal shift assays

    4. Interpretation framework:

      • Correlation of mutational effects with proposed catalytic mechanisms

      • Comparison across different cls enzymes to identify conserved mechanisms

      • Integration with structural information from related enzymes

    Research has shown that mutation of the putative catalytic motif of ClsC prevents cardiolipin formation, confirming its mechanistic importance . Similar approaches can elucidate the unique catalytic mechanisms of all three E. coli cardiolipin synthases, particularly the unusual PE-utilizing mechanism of ClsC.

  • What approaches can be used to study the physiological roles of cardiolipin in E. coli membranes?

    Investigating the physiological roles of cardiolipin in E. coli membranes requires multifaceted approaches:

    1. Genetic manipulation strategies:

      • Single, double, and triple cls gene knockouts to modulate cardiolipin levels

      • Controlled expression systems for titrating cardiolipin production

      • Strain engineering to alter cardiolipin acyl chain composition

    2. Physiological challenge experiments:

      • Osmotic stress responses (high/low osmolarity media)

      • Temperature stress (heat shock, cold shock)

      • pH stress (acid/alkaline conditions)

      • Oxidative stress challenges

      • Antibiotic susceptibility profiling

    3. Membrane analysis techniques:

      • Fluorescence anisotropy to measure membrane fluidity

      • Laurdan spectroscopy to assess membrane packing

      • Differential scanning calorimetry for phase transition analysis

      • GFP-fusion proteins to visualize cardiolipin-rich domains

    4. Protein-lipid interaction studies:

      • Membrane protein purification with associated lipids

      • Reconstitution experiments with defined lipid compositions

      • Activity assays of membrane proteins in different lipid environments

    Research has demonstrated that all three cardiolipin synthases show increased activity with increasing medium osmolarity, suggesting important roles in osmotic stress adaptation . The growth phase-dependent expression patterns of different cls enzymes further indicate specialized functions in different physiological states .

  • How can researchers investigate potential interactions between YmdB and ClsC?

    Investigating the functional relationship between YmdB and ClsC requires multiple complementary approaches:

    1. Genetic approaches:

      • Co-expression studies from the same or separate plasmids

      • Deletion analysis of gene organization (operon structure)

      • Promoter-reporter fusion assays to study co-regulation

      • Bacterial two-hybrid screening for direct interaction

    2. Biochemical approaches:

      • Co-immunoprecipitation of tagged proteins

      • Pull-down assays with purified components

      • Surface plasmon resonance to measure binding kinetics

      • Crosslinking studies to capture transient interactions

    3. Structural biology approaches:

      • Crystallography or cryo-EM of the complex

      • FRET analysis with fluorescently labeled proteins

      • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

      • NMR titration experiments to identify binding interfaces

    4. Functional assays:

      • In vitro reconstitution of ClsC activity with purified YmdB

      • Dose-dependent effects of YmdB on ClsC activity

      • Mutagenesis of YmdB's macro domain to identify critical residues

      • Analysis of ADP-ribose binding by YmdB and its effect on ClsC

    Research has established that expressing clsC alone results in low cardiolipin levels, while co-expression with ymdB increases cardiolipin to near wild-type levels . The physical proximity of these genes (separated by only one base pair in the same operon) further supports their functional relationship . Understanding this interaction may reveal novel regulatory mechanisms for cardiolipin synthesis.

  • What evolutionary insights can be gained from comparing cardiolipin synthases across different bacterial species?

    Evolutionary analysis of cardiolipin synthases provides insights into bacterial adaptation and phospholipid metabolism diversity:

    1. Sequence analysis approaches:

      • Phylogenetic tree construction of cls homologs

      • Identification of conserved domains and motifs

      • Selection pressure analysis (dN/dS ratios)

      • Ancestral sequence reconstruction

    2. Genomic context analysis:

      • Operon structure conservation across species (e.g., ymdB-clsC arrangement)

      • Correlation with other membrane-related genes

      • Horizontal gene transfer detection

      • Gene duplication and diversification patterns

    3. Comparative biochemistry:

      • Substrate preference evolution (PG-PG vs. PE-PG mechanisms)

      • Catalytic efficiency comparisons

      • Expression pattern differences

      • Regulatory mechanism conservation

    4. Correlation with bacterial physiology:

      • Membrane composition adaptation to different environments

      • Relationship to pathogenicity in different species

      • Stress response variations across bacterial lineages

      • Coevolution with membrane proteins requiring cardiolipin

    The discovery of three distinct cardiolipin synthases in E. coli with different substrate preferences and catalytic mechanisms suggests evolutionary diversification to adapt to varying environmental conditions . The unique PE-utilizing mechanism of ClsC represents a third distinct biochemical pathway for cardiolipin synthesis, differing from both the traditional prokaryotic pathway and the eukaryotic pathway .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.