Recombinant Escherichia coli O127:H6 Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Genetic and Genomic Context

The cobS gene is part of the cob operon (cobUST), which is regulated by cobinamide availability . In E. coli O127:H6 strain E2348/69, the cob operon resides within a genomic region exhibiting high divergence from non-B2 phylogroup strains . Comparative genomics reveals that this operon shares ancestry with Salmonella but underwent extensive rearrangement in E. coli lineages .

Genomic Insights

  • Chromosomal Location: Integrated into the E. coli O127:H6 genome (strain E2348/69) .

  • Conservation: The cobS sequence is homologous to counterparts in Salmonella typhimurium but divergent enough to suggest horizontal gene transfer .

  • Phylogroup Specificity: Absent in E. coli phylogroup B2 strains lacking cobalamin biosynthetic pathways .

Functional Role in Cobalamin Biosynthesis

CobS functions within a multi-enzyme pathway to synthesize adenosylcobalamin:

  1. Substrate Binding: CobS interacts with cobinamide and 5,6-dimethylbenzimidazole .

  2. Catalytic Activity: Transfers the nucleotide moiety to cobinamide-phosphate, forming adenosylcobinamide-GDP .

  3. Cobalt Dependency: Requires cobalt uptake systems (e.g., CbiMNQO transporters) for activity .

Enzyme Activity Data

ParameterValue/Observation
Cofactor RequirementATP-dependent
Optimal pH7.5–8.0 (in vitro assays)
Kinetic EfficiencyEnhanced by co-expression with CobT (dimethylbenzimidazole phosphoribosyltransferase)

Recombinant Expression and Purification

Recombinant CobS is produced via heterologous expression in E. coli with the following protocols:

  • Vector: pET- or pCDF-based plasmids .

  • Induction: IPTG or autoinduction systems.

  • Purification: Affinity chromatography (Ni-NTA for His-tagged proteins), yielding >85% purity .

Yield Optimization Strategies

  • Cobalt Transporters: Co-expression of cbiMNQO increases cobalt availability, boosting CobS activity by 15-fold .

  • Metabolic Engineering: Modular pathway engineering (e.g., combining cobS with cobT and cobU) elevates vitamin B₁₂ production to 307 µg/g DCW .

Biotechnological Relevance

  • Vitamin B₁₂ Production: Engineered E. coli strains expressing cobS achieve de novo B₁₂ synthesis, with yields exceeding 250-fold after optimization .

  • Enzyme Mechanism Studies: Used to elucidate cobalt chelation and nucleotide transfer steps in aerobic B₁₂ pathways .

Industrial Strains

StrainCobS SourceB₁₂ Yield (µg/g DCW)Key Modification
FH329Rhodobacter capsulatus21.96Cobalt chelatase co-expression
FH309E. coli O127:H65.72Modular pathway integration

Comparative Analysis with Homologs

CobS from E. coli O127:H6 shares 65% sequence identity with Salmonella typhimurium CobS but exhibits distinct kinetic properties due to structural variations in the active site .

Challenges and Future Directions

  • Bottlenecks: Cobalt uptake and chelation remain limiting factors in industrial B₁₂ production .

  • Engineering Targets: Fusion proteins or directed evolution to enhance CobS stability and activity under fermentation conditions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
cobS; E2348C_2125; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELTLRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (CobS) and what is its role in E. coli?

Cobalamin synthase (CobS) is an integral membrane protein that catalyzes the penultimate step in the biosynthesis of adenosylcobamide (coenzyme B12), specifically performing the condensation of the activated corrin ring and lower ligand base . This enzyme represents a critical convergence point of two pathways necessary for nucleotide loop assembly in the cobalamin biosynthetic pathway . In E. coli O127:H6, CobS functions within the late steps of the adenosylcobamide biosynthetic pathway, which are required during both de novo synthesis and precursor salvaging . The membrane association of CobS is conserved among all cobamide producers, suggesting an evolutionary advantage to this localization, though the physiological relevance of this association is still being investigated .

What methods are available for assessing CobS activity in experimental settings?

Several methodological approaches have been developed to assess CobS activity:

  • Liposome reconstitution assay: CobS activity increases significantly when inserted into a lipid bilayer, making liposome reconstitution critical for accurate functional assessment . This approach involves purifying the protein and incorporating it into liposomes to create a more physiologically relevant environment for activity measurements.

  • In vitro substrate binding analysis: This method allows for the determination of binding affinities and kinetics of CobS with its substrates .

  • In vivo variant analysis: Systematic mutation of residues and motifs in CobS followed by functional assessment helps identify amino acids critical for enzyme activity .

  • Boronate affinity chromatography: For studying CobS in relation to α-ribazole (α-R) synthesis, this method provides a single-step chromatography purification that avoids additional clean-up required in traditional methods .

What are the optimal expression conditions for producing soluble recombinant CobS in E. coli?

Optimizing the expression of membrane proteins like CobS presents significant challenges. Recent advances in recombinant protein production in E. coli have addressed several key bottlenecks:

  • Translation process control: The majority of recent publications focus on identifying optimal conditions for controlling the translation process to achieve maximal yields of functional exogenous proteins . For membrane proteins like CobS, slower translation rates often improve proper membrane insertion and folding.

  • Strain selection: E. coli strains with deficiencies in certain proteases (like BL21(DE3)) are generally preferred for membrane protein expression, as they reduce degradation of target proteins .

  • Induction conditions: Lower temperatures (16-25°C) and reduced inducer concentrations can significantly improve the yield of functional membrane proteins by allowing sufficient time for proper folding and membrane insertion.

  • Expression vector selection: For CobS, vectors with tightly controlled promoters are essential to prevent leaky expression that could be toxic to the host cells .

  • Co-expression strategies: Co-expressing chaperones or foldases can improve the yield of properly folded and functionally active CobS protein.

The metabolic burden on host cells remains a critical consideration, though experimental results on this aspect are often contradictory . Careful optimization of these parameters is necessary for successful CobS expression.

What purification protocol yields the highest purity and activity of recombinant CobS?

Recent breakthroughs have significantly improved CobS purification methods. A new protocol for isolating Salmonella Typhimurium CobS enzyme yields 96% homogenous protein . While this protocol is for S. Typhimurium CobS, it provides valuable insights for purifying E. coli O127:H6 CobS due to protein similarity between these related enterobacteria.

The optimized purification protocol typically involves:

  • Detergent selection: Choosing the appropriate detergent is crucial for solubilizing membrane proteins without denaturing them. Mild detergents like n-dodecyl-β-D-maltopyranoside (DDM) are often effective.

  • Affinity chromatography: Using affinity tags (His-tag, FLAG-tag) for initial capture, followed by tag removal if necessary for functional studies.

  • Size exclusion chromatography: This step helps separate the target protein from aggregates and other impurities.

  • Lipid addition during purification: Including specific lipids during purification can help maintain protein stability and activity.

  • Activity preservation: Careful buffer composition, including glycerol, reducing agents, and specific salt concentrations, helps maintain enzyme activity throughout purification.

For subsequent functional studies, reconstitution of purified CobS into liposomes is recommended to investigate the effect of the lipid bilayer on CobS function .

How can researchers troubleshoot common issues with CobS expression and solubility?

Troubleshooting CobS expression and solubility issues requires systematic evaluation of several factors:

  • Expression kinetics analysis: Monitoring protein expression at different time points post-induction can help identify optimal harvest times before aggregation occurs.

  • Inclusion body recovery: If CobS forms inclusion bodies, specialized refolding protocols using mild detergents and gradual denaturant removal can recover functional protein.

  • Fusion tag screening: Testing different solubility-enhancing tags (MBP, SUMO, TrxA) can identify the best construct for soluble expression.

  • Lysis buffer optimization: Screening different detergents, salt concentrations, and pH conditions during cell lysis can improve initial solubilization.

  • Co-expression strategies: Identifying and co-expressing partner proteins or chaperones that interact with CobS in vivo can enhance proper folding.

The integration of artificial intelligence tools may help clarify contradictory experimental results regarding metabolic burden and optimize expression conditions, though this approach requires more systematic experimental data collection .

How does membrane association influence CobS activity and what experimental approaches best demonstrate this relationship?

The membrane association of CobS is evolutionarily conserved across all cobamide producers, suggesting important functional significance . Research has shown that CobS activity increases significantly when inserted into a lipid bilayer compared to detergent-solubilized forms . This functional enhancement can be studied through several experimental approaches:

  • Liposome reconstitution: Purified CobS can be reconstituted into liposomes with defined lipid composition to investigate how different membrane environments affect enzyme activity . This approach allows for systematic variation of lipid types and ratios.

  • Nanodiscs: These provide a more stable and defined membrane environment than traditional liposomes and allow precise control over the lipid environment surrounding CobS.

  • Detergent screening: Comparing enzyme activity in different detergents can provide insights into how the amphipathic environment affects function.

  • Mutational analysis of membrane-interacting domains: Targeted mutations in regions predicted to interact with the membrane can help identify specific lipid-protein interactions critical for activity.

  • Lipid binding assays: These can identify specific lipids that interact with CobS and potentially modulate its activity.

A carefully designed experimental approach combining these methods can help elucidate the molecular basis for the enhanced activity of membrane-associated CobS and identify specific lipid requirements for optimal function.

What is known about substrate specificity of E. coli O127:H6 CobS and how can it be experimentally determined?

The substrate specificity of CobS involves its interaction with both the activated corrin ring and the lower ligand base during the condensation reaction in cobamide biosynthesis . Experimental approaches to determine substrate specificity include:

  • In vitro enzyme assays: Using purified CobS with various substrate analogs to measure relative activity rates. This can be performed with the enzyme reconstituted in liposomes to maintain physiological activity levels .

  • Binding affinity studies: Techniques such as isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) can measure the binding affinity of CobS for different substrate analogs.

  • Competitive inhibition assays: These can identify which substrate analogs effectively compete with natural substrates, providing insights into recognition determinants.

  • Structural studies: While challenging with membrane proteins, techniques like cryo-EM or X-ray crystallography with substrate analogs can reveal binding sites and interaction mechanisms.

  • In vivo complementation studies: Testing the ability of CobS to support growth when provided with different cobamide precursors can provide insights into substrate utilization in a cellular context .

Research with E. coli and related bacteria has shown that cobamide-dependent enzymes often have preferences for specific cobamide structures, particularly regarding the lower ligand base . This suggests that CobS may also exhibit preferences for certain substrate configurations, which would be an important consideration for experimental design.

How do mutations in key residues and motifs affect CobS function and cobamide synthesis?

In vivo CobS variant analyses have identified critical residues and motifs needed for cobamide synthase function . These studies provide valuable insights into structure-function relationships in CobS:

  • Conserved residue mutations: Mutations in highly conserved amino acids can result in complete loss of function or altered substrate specificity.

  • Active site residues: Identification of amino acids involved in substrate binding and catalysis helps elucidate the reaction mechanism.

  • Membrane-interacting domains: Mutations in regions that interact with the lipid bilayer can affect membrane association and consequently enzyme activity.

  • Structural motifs: Alterations in key structural elements can affect protein folding, stability, and function.

The effects of these mutations can be assessed through:

  • Growth phenotypes: Testing the ability of mutant CobS to support cobamide-dependent growth in complementation assays.

  • Enzyme activity assays: Measuring the catalytic activity of purified mutant enzymes compared to wild-type.

  • Substrate binding studies: Determining if mutations alter substrate recognition or binding affinity.

  • Stability analyses: Assessing if mutations affect protein stability or membrane integration.

Understanding structure-function relationships in CobS is essential for engineering enzymes with altered properties or improved activities for biotechnological applications.

What is the relationship between cobamide adenosyltransferase (BtuR) and methionine synthase-dependent growth?

Recent research has uncovered an unexpected relationship between cobamide adenosyltransferase (BtuR), adenosylated cobamides, and methionine synthase (MetH) function:

  • BtuR overexpression benefits: Laboratory evolution experiments revealed that overexpression of the cobamide adenosyltransferase BtuR confers a specific growth advantage when E. coli is grown with pseudocobalamin (pCbl), a less-preferred cobamide .

  • Adenosylated cobamides and MetH: Further investigation showed that BtuR and adenosylated cobamides contribute to optimal MetH-dependent growth . This finding was unexpected because MetH traditionally uses methylcobamide, not adenosylcobamide, as its cofactor.

  • Expanded cofactor versatility: These findings suggest a previously unrecognized flexibility in cobamide-dependent enzyme function, where enzymes may utilize alternative forms of cobamides under certain conditions .

This relationship has important implications for understanding cobamide metabolism in E. coli and for designing experiments involving cobamide-dependent pathways. The interaction between BtuR and MetH-dependent growth represents an important area for further research to elucidate the molecular mechanisms underlying this relationship.

How can researchers experimentally determine the full spectrum of cobamide forms utilized by E. coli O127:H6?

Determining the complete spectrum of cobamide forms utilized by E. coli O127:H6 requires a multi-faceted experimental approach:

  • Growth profiling with different cobamides: Testing growth rates and final yields when the bacterium is provided with different natural and synthetic cobamides can reveal utilization preferences . This should be done under conditions where endogenous synthesis is prevented to isolate the effects of exogenous cobamides.

  • Laboratory evolution experiments: Long-term growth with less-preferred cobamides can reveal genetic adaptations that improve utilization, providing insights into usage limitations and adaptive mechanisms .

  • Metabolic labeling and analysis: Using isotopically labeled cobamide precursors followed by LC-MS/MS analysis can track the incorporation of different cobamide forms into bacterial metabolism.

  • Enzyme activity assays: Testing the activity of cobamide-dependent enzymes (including MetH) with different cobamide forms can reveal which are functional cofactors in vitro.

  • Genetic approaches: Analyzing the phenotypes of mutants in cobamide transport, modification, and utilization pathways can reveal interdependencies and functional relationships .

The data from such experiments can be organized into a comprehensive cobamide utilization profile for E. coli O127:H6, which would be valuable for understanding both fundamental metabolism and potential biotechnological applications.

What approaches can be used to study the interaction between CobS and other enzymes in the cobalamin biosynthetic pathway?

Studying protein-protein interactions involving membrane proteins like CobS presents unique challenges but is essential for understanding the coordinated process of cobalamin biosynthesis:

  • Protein-protein interaction methods:

    • Co-immunoprecipitation with antibodies against CobS or potential partner proteins

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Proximity labeling techniques such as BioID or APEX

    • Förster resonance energy transfer (FRET) between fluorescently labeled proteins

    • Cross-linking mass spectrometry to identify interaction interfaces

  • Co-purification studies: Analyzing proteins that co-purify with CobS under mild solubilization conditions can identify stable interaction partners.

  • Genetic approaches:

    • Synthetic genetic array analysis to identify genetic interactions

    • Suppressor screens to identify mutations that compensate for CobS defects

    • Construction of operon fusions to study co-regulation

  • Structural biology: Cryo-electron microscopy could potentially capture CobS in complex with other pathway components.

  • Metabolic pathway reconstruction: In vitro reconstitution of consecutive enzymatic steps can reveal functional coupling between enzymes.

The integration of multiple approaches is likely necessary to build a comprehensive understanding of how CobS interfaces with other components of the cobalamin biosynthetic pathway.

How can artificial intelligence tools be applied to optimize CobS expression and activity?

Artificial intelligence (AI) tools offer promising approaches for optimizing complex biological systems like CobS expression and activity:

What are the most promising approaches for engineering CobS for enhanced activity or altered substrate specificity?

Engineering CobS for improved properties represents an advanced research direction with several promising approaches:

  • Rational design based on structure-function analysis: Using insights from mutational studies and structural predictions to introduce targeted changes to the active site or substrate binding regions .

  • Directed evolution: Developing high-throughput screening methods to identify CobS variants with desired properties from large libraries of mutants.

  • Domain swapping: Exchanging domains between CobS enzymes from different organisms to create chimeric proteins with novel properties.

  • Computational design: Using molecular dynamics simulations and computational protein design tools to predict mutations that might enhance stability or alter specificity.

  • Ancestral sequence reconstruction: Recreating predicted ancestral forms of CobS to understand evolutionary trajectories and potentially access more promiscuous or stable variants.

  • Membrane environment engineering: Modifying the lipid composition to optimize CobS activity, based on the understanding that membrane association significantly affects enzyme function .

  • Co-evolution analysis: Identifying co-evolving residues in CobS that might be important for function or interaction with other proteins or substrates.

The successful engineering of CobS would not only advance our fundamental understanding of this enzyme but could also have applications in the production of vitamin B12 and its analogs for biotechnological and medical purposes.

How does E. coli O127:H6 CobS compare to homologs in other bacterial species?

A comparative analysis of CobS across bacterial species reveals important evolutionary and functional insights:

  • Sequence conservation: Key catalytic residues and structural motifs in CobS are highly conserved across diverse bacterial lineages, indicating their essential role in enzyme function .

  • Membrane association: The integral membrane nature of CobS is conserved among all cobamide producers, suggesting strong evolutionary pressure to maintain this association . This conservation implies a functional advantage to the membrane localization that transcends species boundaries.

  • Taxonomic distribution: CobS homologs are found in diverse bacterial phyla and some archaea, indicating the ancient origin of the cobalamin biosynthetic pathway.

  • Domain architecture: Variations in auxiliary domains or regulatory regions may exist between CobS homologs from different species, potentially reflecting adaptations to specific ecological niches or metabolic contexts.

  • Substrate preferences: Different bacterial species may have evolved subtle variations in CobS substrate specificity, particularly regarding the lower ligand base, reflecting the diversity of naturally occurring cobamides .

Understanding these comparative aspects provides context for interpreting experimental results with E. coli O127:H6 CobS and may suggest evolutionary constraints that should be considered in engineering efforts.

What insights from laboratory evolution studies with cobamides can inform CobS research?

Laboratory evolution experiments with E. coli grown on different cobamides have provided valuable insights relevant to CobS research:

  • Adaptation mechanisms: When grown with pseudocobalamin (pCbl), a less-preferred cobamide, E. coli adapts through genetic changes affecting cobamide transport (BtuB) and modification (BtuR) . These adaptations suggest potential rate-limiting steps in cobamide utilization that may involve CobS directly or indirectly.

  • Unexpected functional relationships: Evolution experiments revealed that adenosylated cobamides contribute to optimal methionine synthase-dependent growth, uncovering previously unknown relationships between different branches of cobamide metabolism .

  • Genetic targets: Sequencing of evolved lines identified potential genetic adaptations in cobamide-related genes that improved growth with less-preferred cobamides . These genetic targets provide candidates for further investigation in relation to CobS function.

  • Metabolic plasticity: The ability of bacteria to adapt to different cobamides demonstrates metabolic flexibility that may extend to the biosynthetic pathway involving CobS .

  • Validation approaches: The experimental design used in these studies, where targeted mutants were constructed to validate findings from evolution experiments, provides a valuable methodological framework for CobS research .

These insights from laboratory evolution studies offer both specific genetic targets and conceptual frameworks that can guide research on CobS function and regulation.

How do environmental factors influence CobS expression and activity in E. coli?

Environmental factors can significantly impact CobS expression and activity through various mechanisms:

Experimental approaches to study these environmental influences include:

  • Transcriptomic and proteomic analyses under different conditions

  • Activity assays with purified enzyme under varying conditions

  • In vivo reporter systems to monitor expression

  • Membrane composition analysis under different growth conditions

Understanding these environmental influences is crucial for designing robust experimental approaches and for interpreting results in the context of changing cellular physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.