Recombinant Escherichia coli O127:H6 Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Purified recombinant RnfE exhibits the following properties:

ParameterSpecification
Purity≥85% (verified by SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol
Stability6–12 months at -20°C/-80°C; avoid freeze-thaw cycles
ApplicationsWestern blot (WB), ELISA, enzymatic assays

The protein retains functionality in vitro, enabling studies on its role in electron transport and energy metabolism .

Functional Role in Electron Transport

The Rnf complex couples electron transfer from reduced ferredoxin to NAD+, generating ion gradients (Na+ or H+) across membranes . Key mechanistic insights include:

  • Ion Translocation: RnfE contributes to Na+ pumping, critical for ATP synthesis in anaerobic bacteria .

  • Redox Coupling: Facilitates electron flow between ferredoxin (E' ≈ -500 mV) and NAD+ (E' ≈ -320 mV), enabling energy conservation under low-redox conditions .

  • Genetic Context: The rnf operon in E. coli O127:H6 includes rnfABCDGE, with rnfE encoding a core subunit essential for complex assembly .

Research Applications

Recombinant RnfE is utilized in:

  • Enzyme Kinetics: Studying electron transfer rates and ion-pumping efficiency .

  • Structural Biology: Crystallization trials to resolve Rnf complex architecture .

  • Antibiotic Development: Targeting Rnf-mediated energy pathways in pathogenic bacteria .

Evolutionary and Physiological Significance

Phylogenetic analyses indicate that Rnf complexes are widespread in anaerobic bacteria and archaea, underscoring their role in ancient energy-conserving mechanisms . In E. coli O127:H6, RnfE supports pathogenesis by maintaining cellular redox balance during infection .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
rsxE; E2348C_1719; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
rsxE
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDEKMKKRRTEAAAERALPNGETGNV
Uniprot No.

Target Background

Function
RnfE is a component of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane. It plays a critical role in maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Escherichia coli O127:H6 Electron transport complex protein RnfE (rnfE)?

Recombinant Escherichia coli O127:H6 Electron transport complex protein RnfE (rnfE) is a protein component of the bacterial electron transport chain that plays a crucial role in energy metabolism. Similar to the RnfE protein found in E. coli O9:H4, it is typically a membrane-associated protein involved in ion-translocating oxidoreductase activity. The recombinant version refers to the protein produced through genetic engineering techniques, typically incorporating an affinity tag (such as His-tag) to facilitate purification and downstream applications. The Enteropathogenic E. coli O127:H6 strain represents a clinically significant bacterial variant with unique metabolic and pathogenic properties that can be studied through its component proteins like RnfE .

What is the function of RnfE protein in the bacterial electron transport chain?

RnfE functions as a critical component of the ion-translocating oxidoreductase complex in bacterial electron transport systems. Based on related RnfE proteins, it is likely involved in the transfer of electrons across the membrane, contributing to the generation of a proton gradient that drives ATP synthesis. The protein contains transmembrane domains that anchor it within the bacterial membrane, where it interacts with other components of the electron transport complex. RnfE is part of the wider Rnf complex (Rhodobacter nitrogen fixation) that couples the oxidation-reduction reactions to the translocation of ions across the membrane, thus participating in energy conservation mechanisms that are fundamental to bacterial survival .

What are the common synonyms and alternative designations for RnfE in scientific literature?

When researching RnfE in scientific databases and literature, researchers should be aware of several synonyms and alternative designations. Based on related RnfE proteins, these may include rsxE, Ion-translocating oxidoreductase complex subunit E, and Rsx electron transport complex subunit E. The protein may also be referenced by its UniProt ID in databases. Understanding these alternative designations is crucial for comprehensive literature searches and database mining, especially when conducting cross-species comparisons or evolutionary analyses of electron transport proteins. These nomenclature variations reflect the historical development of understanding this protein's function and its classification within different protein families .

How should recombinant RnfE protein be stored to maintain stability?

Proper storage is critical for maintaining the stability and activity of recombinant RnfE protein. Based on protocols for similar proteins, lyophilized RnfE should be stored at -20°C to -80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles that can degrade protein structure. For working solutions, it is recommended to store aliquots at 4°C for up to one week to minimize degradation. The protein is typically maintained in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 to enhance stability. For long-term storage, adding glycerol to a final concentration of 50% before aliquoting and storing at -20°C/-80°C is recommended. These storage conditions help preserve the protein's native conformation and functional properties for subsequent experimental applications .

What are the recommended reconstitution procedures for lyophilized RnfE protein?

For optimal reconstitution of lyophilized RnfE protein, researchers should first briefly centrifuge the vial to bring all contents to the bottom before opening. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance stability for storage after reconstitution, it is advisable to add glycerol to a final concentration of 5-50%, with 50% being the standard recommendation for long-term storage. After reconstitution, the solution should be gently mixed until completely dissolved, avoiding vigorous shaking that could cause protein denaturation. For membrane proteins like RnfE, complete solubilization may require additional considerations due to their hydrophobic nature. The reconstituted protein should be aliquoted to avoid repeated freeze-thaw cycles and stored according to the recommended storage conditions .

What experimental designs are most appropriate for studying RnfE function?

When studying RnfE function, researchers should implement systematic experimental designs that control for multiple variables. A factorial design is particularly valuable as it allows for the assessment of multiple factors simultaneously, such as pH, temperature, and substrate concentration, which all may affect RnfE activity. Using randomized complete block designs can help control for extraneous variables that might influence experimental outcomes. For kinetic studies, researchers should establish clearly defined independent variables (e.g., substrate concentration) and dependent variables (e.g., electron transfer rate) while controlling for potential confounding factors like protein purity and buffer composition. Additionally, implementing both negative and positive controls is essential for validating experimental results, especially when studying the effects of mutations or inhibitors on RnfE function .

How can researchers effectively design experiments to study protein-protein interactions involving RnfE?

To effectively study protein-protein interactions involving RnfE, researchers should employ a multi-method approach. Begin with hypothesis formulation based on sequence analysis and structural predictions, then systematically design experiments with clearly defined variables. Co-immunoprecipitation assays can verify physical interactions between RnfE and potential partner proteins, while FRET (Förster Resonance Energy Transfer) or BRET (Bioluminescence Resonance Energy Transfer) techniques provide information about spatial proximity in living cells. For quantitative analysis, surface plasmon resonance or isothermal titration calorimetry can determine binding affinities and thermodynamic parameters. Crosslinking studies combined with mass spectrometry can identify interaction interfaces. Throughout these experiments, researchers must include appropriate controls to rule out non-specific interactions and ensure proper protein folding and activity. The experimental design should include randomization and replication to enhance statistical power and reliability of results .

What computational approaches are most useful for analyzing RnfE in bacterial systems?

Computational analysis of RnfE in bacterial systems benefits from an integrated approach combining multiple techniques. Researchers should consider employing sequence-based analyses including multiple sequence alignments to identify conserved domains and phylogenetic comparisons across bacterial species. Structural prediction tools can generate models of RnfE's three-dimensional conformation, while molecular dynamics simulations can explore conformational changes during electron transport. For systems-level understanding, knowledge-based network analysis is particularly valuable, as it allows researchers to integrate data from separate studies and related proteins to identify functional relationships. This approach can incorporate artificial intelligence and natural language processing to mine electronic records and literature for relevant information. Additionally, algorithms designed specifically for proteomics data can help identify post-translational modifications and protein-protein interaction networks involving RnfE, providing a comprehensive view of its role in bacterial metabolism4.

How does RnfE interact with other components of the electron transport complex?

RnfE interacts with multiple components of the electron transport complex through specific protein-protein interfaces that facilitate electron transfer. Based on studies of similar systems, these interactions likely involve both hydrophobic contacts within the membrane and electrostatic interactions at the membrane periphery. The transmembrane domains of RnfE create a scaffold that positions key residues for optimal electron transfer to partner proteins. Specifically, RnfE may interact with other Rnf complex subunits (RnfA, RnfB, RnfC, RnfD, and RnfG) to form a functional ion-translocating oxidoreductase. The precise stoichiometry and arrangement of these interactions can be studied using crosslinking experiments followed by mass spectrometry analysis. Additionally, mutagenesis studies targeting conserved residues can reveal which amino acids are critical for these protein-protein interactions and subsequent electron transfer activities. Understanding these interactions is essential for comprehending the functional mechanics of the entire electron transport chain 4.

How does the structure of RnfE relate to its electron transport function?

The structure of RnfE is intimately tied to its electron transport function through several key features. The protein contains multiple transmembrane domains that anchor it within the bacterial membrane, creating a conduit for electron transfer across the lipid bilayer. Based on analysis of similar proteins, RnfE likely contains cofactor binding sites that facilitate electron transfer, possibly including iron-sulfur clusters or other redox-active centers. The arrangement of hydrophobic and hydrophilic residues creates microenvironments that optimize the energetics of electron transfer while maintaining the protein's stability within the membrane. The transmembrane helices may also participate in proton translocation coupled to electron transfer, contributing to the generation of proton motive force. Structural elements facing the cytoplasm or periplasm likely mediate interactions with soluble electron donors or acceptors. Advanced structural biology techniques such as cryo-electron microscopy or X-ray crystallography would be valuable for elucidating these structure-function relationships in greater detail .

How can researchers differentiate between the roles of RnfE and related proteins in the electron transport chain?

Differentiating between the roles of RnfE and related proteins in the electron transport chain requires a systematic experimental approach combining genetic, biochemical, and biophysical techniques. Researchers should start with gene knockout or knockdown studies to observe phenotypic changes specific to RnfE deficiency compared to the absence of other related proteins. Complementation experiments can confirm the specificity of observed phenotypes. Biochemical assays measuring electron transfer rates in the presence of specific substrates can identify unique functional properties of RnfE. Protein-protein interaction studies using techniques like crosslinking followed by mass spectrometry can map the interaction network specific to RnfE versus related proteins. Additionally, researchers should employ spectroscopic methods to characterize the redox properties of RnfE, revealing its unique contribution to electron transport. Finally, comparative analysis across different bacterial species can highlight conserved versus species-specific functions of RnfE. This multi-faceted approach enables a comprehensive differentiation of RnfE's role from those of related proteins 4.

How can researchers validate RnfE interactions with other proteins in the bacterial membrane?

Validating RnfE interactions with other membrane proteins requires a multi-faceted approach that addresses the challenges of studying hydrophobic membrane proteins. Researchers should begin with in vivo crosslinking techniques followed by co-immunoprecipitation and mass spectrometry to identify interaction partners under physiological conditions. For higher resolution analysis, targeted approaches like FRET or BRET can provide spatial information about specific protein pairs within the membrane. Functional validation through co-purification of active complexes combined with activity assays can confirm that identified interactions are physiologically relevant. Split-protein complementation assays, where protein fragments regain function only when brought together by interacting partners, offer another validation approach. Researchers should also consider genetic approaches, such as synthetic lethality or suppressor mutations, which can reveal functional relationships between genes encoding interacting proteins. Computational docking studies based on structural models can predict interaction interfaces that can then be tested through site-directed mutagenesis. This comprehensive validation strategy ensures that identified interactions represent genuine biological phenomena rather than experimental artifacts 4.

What are the implications of RnfE function for understanding bacterial pathogenicity?

The study of RnfE function has significant implications for understanding bacterial pathogenicity, particularly in enteropathogenic E. coli O127:H6. As a component of the electron transport chain, RnfE contributes to energy metabolism that powers virulence mechanisms. Pathogens must adapt their energy metabolism to changing host environments, making electron transport proteins potential regulators of virulence gene expression. RnfE may affect the bacterium's ability to persist under oxygen-limited conditions in the host intestinal tract, influencing colonization efficiency. The protein might also indirectly impact virulence factor production through its effects on cellular energy status. Understanding these connections could reveal how metabolic adaptations and pathogenicity are linked in enteropathogenic strains. Additionally, since electron transport chains are critical for bacterial survival, RnfE and related proteins represent potential targets for novel antimicrobial development. Future research should focus on elucidating the specific relationships between RnfE activity, metabolic adaptation, and virulence factor expression in host-pathogen interactions .

How can structural studies of RnfE contribute to antimicrobial drug development?

Structural studies of RnfE hold significant potential for antimicrobial drug development through multiple pathways. Detailed structural information can identify druggable pockets unique to bacterial RnfE that are absent in host proteins, enabling the design of selective inhibitors. High-resolution structures obtained through X-ray crystallography or cryo-electron microscopy can guide structure-based drug design efforts targeting critical functional domains. Understanding the conformational changes that occur during electron transport can reveal opportunities to disrupt protein dynamics essential for function. Comparative structural analysis between RnfE proteins from different bacterial species can identify conserved features that might serve as broad-spectrum targets while highlighting species-specific elements for narrow-spectrum approaches. Structural information about protein-protein interaction interfaces within the electron transport complex could lead to the development of drugs that disrupt these essential interactions. Since bacterial energy metabolism is critical for survival and pathogenicity, inhibitors of RnfE function could potentially impair bacterial growth and virulence without directly affecting host cells, offering a promising approach for next-generation antimicrobials with reduced resistance potential .

What emerging technologies might enhance future research on RnfE and related electron transport proteins?

Future research on RnfE and related electron transport proteins will benefit from several emerging technologies that offer unprecedented resolution and analytical capabilities. Advances in cryo-electron microscopy now enable structural determination of membrane protein complexes in their native lipid environment, potentially revealing the complete architecture of RnfE-containing complexes. Single-molecule techniques like atomic force microscopy combined with fluorescence can track conformational changes during electron transport in real-time. CRISPR-based gene editing systems allow precise manipulation of RnfE in its native genomic context, enhancing the specificity of functional studies. Microfluidic systems that create controlled gradients can simulate the dynamic environments bacteria encounter, revealing context-dependent functions of RnfE. Advanced computational approaches including molecular dynamics simulations with enhanced sampling methods can model electron transfer processes at atomic resolution. Multi-omics integration platforms can correlate changes in RnfE activity with global cellular responses. Finally, artificial intelligence approaches that mine literature and integrate diverse datasets can generate novel hypotheses about RnfE function that might not be apparent through traditional analysis methods 4.

What are common challenges in expressing and purifying recombinant RnfE protein?

Expressing and purifying recombinant RnfE protein presents several challenges due to its nature as a membrane protein. Researchers commonly encounter low expression levels as the hydrophobic transmembrane domains can cause toxicity to host cells and protein aggregation. Optimizing expression conditions by adjusting temperature (typically lowering to 16-20°C), inducer concentration, and expression duration can improve yields. Selection of appropriate expression systems is critical; while E. coli is commonly used for bacterial proteins, specialized strains designed for membrane protein expression may provide better results. For purification, careful selection of detergents is essential to solubilize RnfE from membranes while maintaining its native conformation and function. A two-step purification approach is often necessary, combining affinity chromatography (utilizing the His-tag) followed by size exclusion chromatography to achieve high purity. Researchers should confirm proper folding through functional assays, as membrane proteins are particularly prone to misfolding during recombinant expression. Adding stabilizing agents like glycerol to purification buffers can help maintain protein integrity throughout the process .

How can researchers ensure reproducibility in RnfE functional assays?

Ensuring reproducibility in RnfE functional assays requires meticulous attention to experimental variables and standardization of protocols. Researchers should first establish detailed standard operating procedures (SOPs) that specify all experimental parameters, including protein concentration, buffer composition, pH, temperature, and incubation times. Protein quality control is essential; each batch of purified RnfE should undergo verification of purity (via SDS-PAGE), concentration (via Bradford or BCA assay), and proper folding (via circular dichroism or activity assays) before use in functional studies. Implementing internal controls within each experiment, including positive and negative controls, provides benchmarks for assay performance. Environmental conditions should be carefully controlled and monitored, as temperature fluctuations can significantly impact enzyme kinetics. Statistical approaches including technical replicates (same protein preparation, multiple measurements) and biological replicates (different protein preparations) help distinguish between technical variation and genuine biological effects. Researchers should also consider blind testing, where the person performing the assay is unaware of sample identity, to minimize unconscious bias. Finally, detailed reporting of all methods and materials in publications enhances the ability of other researchers to reproduce findings .

What quality control measures should be implemented when working with recombinant RnfE?

Comprehensive quality control measures are essential when working with recombinant RnfE to ensure experimental reliability. Researchers should verify protein identity through mass spectrometry and/or western blotting with specific antibodies. Purity assessment using SDS-PAGE with densitometry analysis should confirm >90% purity, with particular attention to contaminants that might influence functional assays. Batch-to-batch consistency checks comparing multiple protein preparations can identify variability in the expression and purification process. Functional validation through activity assays specific to RnfE's electron transport capability confirms that the protein retains its native function after purification. Stability testing under storage conditions should be performed periodically to determine the viable lifetime of protein preparations. For structural integrity, circular dichroism spectroscopy can verify proper secondary structure content. Additionally, endotoxin testing is advisable for preparations intended for immunological studies, as bacterial expression systems often introduce lipopolysaccharide contaminants. Implementing and documenting these quality control measures creates a foundation for reliable experimental outcomes and facilitates troubleshooting when unexpected results occur .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.