Recombinant Escherichia coli O127:H6 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdC; E2348C_4480; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (anaerobic growth) and succinate dehydrogenase (aerobic growth). FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the fumarate reductase complex contribute to bacterial energy metabolism?

Fumarate reductase (QFR) is a key enzyme induced during anaerobic growth of bacteria. It catalyzes the final step in microbial anaerobic respiration by reducing fumarate to succinate using electrons derived from quinol oxidation . This reaction is represented as:

succinate + quinone ⟺ fumarate + quinol

The enzyme is activated and synthesized under low oxygen conditions when aerobic respiration cannot be performed, allowing the cell to continue energy production through anaerobic respiration . Notably, this reaction is the opposite of the reaction catalyzed by succinate dehydrogenase (Complex II) in the aerobic respiratory chain .

The crystal structure analysis at 3.3 Å resolution revealed that the cofactors in fumarate reductase are arranged in a nearly linear manner from the membrane-bound quinone to the active site flavin, facilitating efficient electron transfer . Although fumarate reductase is not associated with proton-pumping, the two quinones are positioned on opposite sides of the membrane, similar to the Q-cycle organization observed in cytochrome bc1 .

What techniques are most effective for site-directed mutagenesis studies of FrdC?

Based on published research methodologies, effective site-directed mutagenesis approaches for FrdC include:

  • PCR-based methods: Using primers containing the desired mutations with high-fidelity polymerases such as Phusion High-Fidelity DNA polymerase . A typical PCR system would include:

    • 10 μl of buffer

    • 1 μl of dNTP (10 mM of each dNTP)

    • 20 ng of DNA template

    • 2 μl of each primer (10 μM)

    • 0.5 μl of Phusion polymerase (2.5 U/μL)

    • Water to 50 μl total volume

  • PCR cycling conditions:

    • Initial denaturation: 98°C for 2 minutes

    • 30 cycles of: 98°C for 10 seconds, 56°C for 10 seconds, 72°C for 30 seconds

    • Final extension: 72°C for 5 minutes

  • Transformation and selection strategies: After mutagenesis, plasmids can be transformed into E. coli using calcium chloride transformation or electroporation (2.5 kV) . For electroporation, competent cells are prepared according to methods described by Dower et al., with transformation efficiencies typically reaching 10⁹-10¹⁰ transformants per μg of DNA .

  • Verification methods: Mutations should be confirmed by DNA sequencing, and unwanted mutations ruled out by sequencing the entire gene of interest .

Studies have successfully used these techniques to generate mutations in key residues such as FrdC-E29, FrdC-H82, and others to evaluate their functional significance in quinone interactions .

How can researchers effectively characterize quinone interactions with FrdC?

Characterization of quinone interactions with FrdC can be achieved through several complementary approaches:

  • Enzymatic activity assays: Measure both quinol oxidation and quinone reduction activities using artificial electron donors/acceptors. The standard assay involves monitoring fumarate reduction by DMNH₂ (dimethylnaphthoquinol) spectrophotometrically at 37°C . Comparison between membrane-bound and detergent-solubilized enzyme preparations can provide insights into the membrane dependency of quinone interactions .

  • Solvent isotope effect analysis: This approach can identify rate-limiting proton transfer steps involved in quinone interactions. Comparing reaction rates in H₂O versus D₂O buffers can reveal whether proton transfer is involved in the rate-limiting step .

  • Redox potential measurements: Determine the oxidation-reduction midpoint potentials of heme groups before and after mutation of key residues to assess their contribution to electron transfer pathways .

  • Structural analysis: X-ray crystallography of wild-type and mutant enzymes at resolutions of 2.0-3.0 Å can reveal structural changes affecting quinone binding sites . For example, the structure of E. coli fumarate reductase has been solved at 3.3 Å resolution, showing the arrangement of cofactors from the membrane-bound quinone to the active site flavin .

  • Kinetic analysis: Determine Michaelis constants (Km) for quinone substrates to assess affinity changes resulting from mutations .

What is the molecular mechanism of electron transfer through the FrdC subunit?

The electron transfer mechanism through FrdC involves a complex interplay of protein structure, cofactor arrangement, and specific amino acid residues:

  • Cofactor arrangement: The crystal structure of fumarate reductase reveals that cofactors are arranged in a nearly linear manner from the membrane-bound quinone to the active site flavin . This arrangement facilitates efficient electron transfer across the protein complex.

  • Critical residues in quinone interactions: Site-directed mutagenesis studies have identified several key residues in FrdC that are essential for quinone interactions:

    • FrdC-E29: The negative charge at this position is crucial for deprotonation of menaquinol

    • FrdC-H82: The positive charge here is required for stabilization of the quinone radical intermediate

    • Other important residues include FrdC-A32, FrdC-F38, FrdC-W86, and FrdC-F87

  • Proton-coupled electron transfer: In some fumarate reductases (such as in Wolinella succinogenes), transmembrane electron transfer via heme groups is strictly coupled to proton transfer. The "E pathway hypothesis" proposes that electron transfer is coupled to proton cotransfer via a transiently established pathway involving residues like Glu-C180 .

  • Quinone binding sites: FrdC contains a QB-type quinone binding site (involving residues E29, A32, H82, W86), while FrdD contains residues (F57, Q59, S60) that form an apolar QA-type site . This arrangement resembles the organization found in photosynthetic reaction centers.

Experimental evidence supporting this mechanism includes:

  • Mutations in key residues significantly affect both quinol oxidase and quinone reductase activities

  • Solvent isotope effect studies indicate the presence of rate-limiting proton transfer steps

  • Changes in oxidation-reduction heme midpoint potentials in mutant enzymes demonstrate the role of specific residues in facilitating electron transfer

How does the frdABCD operon regulation respond to different environmental conditions?

The frdABCD operon in E. coli is subject to sophisticated regulation in response to environmental conditions, particularly the availability of terminal electron acceptors:

  • Oxygen regulation: Expression of the frdABCD operon is increased approximately 10-fold during anaerobic growth compared to aerobic conditions . This anaerobic induction is mediated by the Fnr (Fumarate and Nitrate reductase Regulatory) protein, as demonstrated by impaired frdA'-'lacZ expression in fnr mutants and restoration when the fnr+ gene is provided in trans .

  • Substrate induction: The presence of fumarate, the substrate of fumarate reductase, increases expression by an additional 1.5-fold under anaerobic conditions .

  • Nitrate repression: Nitrate, a preferred electron acceptor, decreases frdABCD expression by approximately 23-fold . This repression occurs under both aerobic and anaerobic conditions in both wild-type and fnr mutant strains, indicating that nitrate repression is independent of nitrate respiration and oxygen control imparted by Fnr .

  • Other electron acceptors: The addition of trimethylamine-N-oxide as an electron acceptor does not significantly alter frdA'-'lacZ expression .

The regulatory model involves:

  • Fnr protein acting as an anaerobic activator of frd operon expression

  • A separate mechanism for nitrate repression that is independent of oxygen control

  • Fnr gene expression occurring under both aerobic and anaerobic conditions

This multi-layered regulation ensures that fumarate reductase is optimally expressed when needed for anaerobic respiration with fumarate as the terminal electron acceptor, while being repressed when more energetically favorable electron acceptors like oxygen or nitrate are available.

What approaches can resolve inconsistent results in FrdC mutagenesis studies?

When encountering inconsistent results in FrdC mutagenesis studies, researchers should consider the following approaches:

  • Compare membrane-bound versus solubilized enzyme preparations: Studies have shown that some FrdC mutants (like those at position E180 in W. succinogenes) completely lack quinol oxidation activity when membrane-bound but retain approximately 10% of wild-type activity when solubilized . This suggests that the membrane environment significantly affects enzyme function, and both preparations should be tested.

  • Examine multiple enzymatic activities: Assess different activities of the enzyme complex:

    • Quinol oxidase activity (physiological direction)

    • Quinone reductase activity (reverse reaction)

    • Succinate oxidation by artificial electron acceptors (independent of membrane anchor subunits)

  • Analyze growth phenotypes: Test the ability of mutant strains to grow under selective conditions requiring functional enzyme, such as anaerobic growth with fumarate as the terminal electron acceptor .

  • Combine structural and functional studies: Integrate X-ray crystallography data with biochemical analyses to rule out structural changes that might account for altered activities . For instance, the refined crystal structures of W. succinogenes QFR variants at 2.19 Å and 2.76 Å resolution ruled out major structural changes as the cause of activity differences .

  • Analyze redox properties: Measure changes in oxidation-reduction midpoint potentials of cofactors in mutant enzymes to identify alterations in electron transfer pathways .

  • Solvent isotope effect analysis: Compare reaction rates in H₂O versus D₂O to identify specific proton transfer steps affected by mutations .

When these approaches are combined, they can provide a comprehensive understanding of the true molecular mechanisms and resolve apparently contradictory experimental results, as demonstrated in studies of the "E pathway hypothesis" in W. succinogenes QFR .

What are the optimal conditions for expressing and purifying recombinant FrdC for structural studies?

Based on published research methods, the optimal conditions for expressing and purifying recombinant FrdC for structural studies include:

  • Expression systems:

    • Host strain: E. coli strains lacking endogenous fumarate reductase genes (ΔfrdABCD) are preferred to avoid contamination with native enzyme

    • Growth conditions: Anaerobic growth with nitrate as the terminal electron acceptor, supplemented with brain-heart infusion broth (0.5% mass/vol) for optimal growth

    • Temperature: 30-37°C depending on the specific construct

  • Purification strategy:

    • Membrane preparation: Cells should be harvested and disrupted by methods that preserve membrane integrity, such as French press or sonication

    • Solubilization: Mild detergents like Triton X-100 are effective for extracting the membrane-bound enzyme while maintaining activity

    • Chromatography: A combination of ion exchange and affinity chromatography yields the purest preparation

    • Quality control: Assess purity by SDS-PAGE and specific activity measurements using standard assays such as succinate oxidation by methylene blue or fumarate reduction by DMNH₂

  • Buffer conditions:

    • For crystallization: The enzyme is typically maintained in a buffer containing 50 mM Tris-HCl (pH 7.6), 0.1% Triton X-100, and 10% glycerol

    • For activity assays: 50 mM sodium phosphate buffer (pH 7.4) with appropriate electron donors/acceptors

  • Storage:

    • For extended storage, the purified enzyme can be stored at -80°C in buffer containing glycerol (20-50%) as a cryoprotectant

    • The recombinant protein should be stored in Tris-based buffer with 50% glycerol, optimized for protein stability

Following these optimized protocols has enabled successful structural studies, including the determination of the crystal structure of intact fumarate reductase at 3.3 Å resolution .

How does FrdC in E. coli O127:H6 compare with other E. coli strains and related bacteria?

Comparative analysis of FrdC across different bacterial species and strains reveals important insights about evolutionary conservation and functional specialization:

  • Comparison among E. coli strains:

    • The enteropathogenic E. coli O127:H6 strain E2348/69 has been fully sequenced and serves as a prototype for studying EPEC biology and virulence

    • Genomic analysis identified 424 E2348/69-specific genes, though the core metabolic genes including the frd operon are generally conserved across E. coli strains

    • E. coli O127:H6 belongs to phylogroup B2, which has specific genetic traits conserved irrespective of pathotypes

  • Comparison with other bacterial species:

    • FrdC from different species shares structural and functional conservation in quinone binding sites

    • In W. succinogenes, the QFR enzyme contains a diheme structure and exhibits proton-coupled electron transfer mechanisms not observed in E. coli

    • The Wolinella enzyme contains the critical residue Glu-C180, which plays an essential role in quinol oxidation activity and is part of the proposed "E pathway" for transmembrane electron and proton transfer

  • Functional conservation:

    • The QB-type and QA-type quinone binding sites identified in E. coli FrdC/FrdD are structurally similar to those found in photosynthetic reaction centers, suggesting evolutionary conservation of quinone-binding motifs across diverse organisms

    • The arrangement of two quinones on opposite sides of the membrane in a Q-cycle-like organization appears to be a conserved feature in fumarate reductases and related enzymes

This comparative analysis highlights both the functional conservation of essential metabolic enzymes across bacteria and the specific adaptations that have evolved in different species to optimize function under various environmental conditions.

What research approaches can effectively explore the relationship between FrdC structure and respiratory adaptation?

To effectively explore the relationship between FrdC structure and respiratory adaptation, researchers should consider these integrated approaches:

These approaches, when integrated, can provide comprehensive insights into how FrdC structure has evolved to optimize bacterial respiration across diverse environmental conditions, from the oxygen-rich surface waters to anaerobic sediments, and from neutral to acidic or alkaline environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.