Recombinant Escherichia coli O127:H6 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O127:H6 Fumarate Reductase Subunit D (FrdD)

Fumarate reductase subunit D (FrdD) is a protein component of the fumarate reductase enzyme complex found in Escherichia coli ( E. coli) . Specifically, Recombinant Escherichia coli O127:H6 Fumarate reductase subunit D (FrdD) refers to the FrdD protein that is produced using recombinant DNA technology in Escherichia coli O127:H6 strain .

The fumarate reductase complex catalyzes the reduction of fumarate to succinate, which is an important step in anaerobic respiration . This process allows the bacterium to generate energy in the absence of oxygen, using fumarate as the terminal electron acceptor . The enzyme complex consists of four subunits, FrdA, FrdB, FrdC, and FrdD .

  • FrdA and FrdB These are catalytic subunits that contain the active sites for fumarate reduction and harbor redox cofactors such as flavin adenine dinucleotide (FAD) and iron-sulfur clusters .

  • FrdC and FrdD These are membrane-anchoring subunits that bind quinones and attach the catalytic components to the inner cell membrane .

Structure and Function of FrdD

FrdD is an integral membrane protein that plays a crucial role in anchoring the fumarate reductase complex to the cytoplasmic membrane . Each FrdD subunit has three transmembrane helices connected by periplasmic loops, with the N-terminus located in the cytoplasm and the C-terminus in the periplasm . These transmembrane helices create binding pockets for menaquinone molecules, which are essential for electron transport within the respiratory chain .

Key Functions of FrdD

  • Anchoring: FrdD anchors the catalytic components of the fumarate reductase complex (FrdA and FrdB) to the cell's inner membrane .

  • Quinol Binding: FrdD binds quinones, which are essential for the electron transfer process during fumarate reduction .

  • Electron Transport: Together with FrdC, FrdD facilitates the transfer of electrons from menaquinone to the catalytic subunits, enabling the reduction of fumarate to succinate .

Biochemical characteristics

PropertyDescription
Molecular WeightApproximately 13 kDa
Amino Acid SequenceThe full-length protein consists of 119 amino acids. Examples of the AA sequence: MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
SubunitPart of the four-subunit fumarate reductase complex (FrdA, FrdB, FrdC, FrdD)
FunctionAnchors the catalytic subunits to the membrane, binds quinones, and participates in electron transport
InteractionsInteracts with FrdC to form the membrane anchor domain; binds menaquinone
ExpressionExpressed under anaerobic conditions when fumarate is used as an electron acceptor
SynonymsFumarate reductase 13 kDa hydrophobic protein, Quinol:fumarate oxidoreductase (QFR)
ApplicationsSuitable for use in enzyme activity assays, structural studies, and mechanistic investigations of fumarate reductase. Can be used to study anaerobic respiration, electron transport, and quinone binding . Useful as an antigen for antibody production and as a control or standard in immunoassays. May be employed in metabolic engineering to enhance anaerobic growth or production of succinate .

Role in Anaerobic Respiration

In anaerobic conditions, E. coli uses fumarate as an alternative electron acceptor to oxygen. The fumarate reductase complex, including FrdD, plays a vital role in this process . Electrons from NADH or other electron donors are transferred to menaquinone, then to the fumarate reductase complex, where fumarate is reduced to succinate . This reaction generates a proton motive force that drives ATP synthesis, thus sustaining energy production in the absence of oxygen .

Fumarate Reductase and Succinate Dehydrogenase

Fumarate reductase (FRD) is functionally and structurally homologous to succinate dehydrogenase (SDH) . FRD catalyzes the reduction of fumarate to succinate during anaerobic respiration, while SDH catalyzes the reverse reaction, oxidizing succinate to fumarate during aerobic respiration .

Research and Applications

  • Enzyme Activity Assays: Recombinant FrdD can be used in enzyme activity assays to measure the activity of the fumarate reductase complex under different conditions .

  • Structural Studies: Recombinant FrdD is essential for structural studies aimed at understanding the architecture of the fumarate reductase complex and its interaction with quinones .

  • Drug Discovery: Fumarate reductase is a potential drug target in pathogenic bacteria. Recombinant FrdD can be used to screen for inhibitors that disrupt its function .

  • Metabolic Engineering: Recombinant FrdD can be employed in metabolic engineering to enhance succinate production in E. coli or other microorganisms .

  • Anaerobic Growth Studies: Recombinant FrdD is useful for studying the role of fumarate reductase in anaerobic growth and survival .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
frdD; E2348C_4479; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is employed during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. The FrdD subunit anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of FrdD in the fumarate reductase complex?

FrdD functions as one of two membrane anchor subunits (along with FrdC) in the fumarate reductase complex. Together, FrdC and FrdD are required for membrane association of the enzyme and for the oxidation of reduced quinone analogues. These membrane subunits accept electrons from quinols and transfer them to the iron-sulfur subunit (FrdB), which subsequently transfers the electrons to the catalytic subunit (FrdA) where fumarate is reduced to succinate .

The four-subunit structure forms a functional respiratory complex that enables E. coli to use fumarate as a terminal electron acceptor during anaerobic growth. Studies have demonstrated that all four fumarate reductase subunits must be present to restore anaerobic growth on glycerol and fumarate in frd-deficient E. coli strains .

How does the fumarate reductase complex function in E. coli metabolism?

The fumarate reductase complex plays a crucial role in anaerobic respiration in E. coli, particularly when oxygen is unavailable as an electron acceptor. The enzyme catalyzes the final step in this anaerobic respiratory pathway:

Fumarate + 2e⁻ + 2H⁺ → Succinate

The reaction is carried out through a coordinated electron transfer chain:

  • Reduced quinones (quinols) donate electrons to the membrane anchor subunits (FrdC and FrdD)

  • Electrons are transferred to the iron-sulfur centers in FrdB

  • FrdB transfers the electrons to the FAD cofactor in FrdA

  • The FAD cofactor reduces fumarate to succinate at the active site of FrdA

This process allows E. coli to generate a proton gradient across the membrane for ATP synthesis during anaerobic conditions . The functional assembly of all four subunits is essential for this metabolic pathway, as demonstrated by complementation studies where introduction of all four fumarate reductase subunits was required for restoration of anaerobic growth on glycerol and fumarate .

What are the optimal conditions for cloning and expressing recombinant E. coli O127:H6 frdD?

For successful cloning and expression of recombinant E. coli O127:H6 frdD, consider the following methodological approach:

Vector Selection:
Choose expression vectors with appropriate promoters for controlled expression. For membrane proteins like FrdD, vectors with moderate expression levels (such as pBAD or pET vectors with tunable induction) help prevent toxicity and inclusion body formation .

Strain Selection:
Use E. coli strains optimized for membrane protein expression such as C41(DE3) or C43(DE3), which are derived from BL21(DE3) but better tolerate membrane protein overexpression. For complementation studies, the E. coli MI1443 strain (lacking the chromosomal frd operon) has been successfully used to test functionality .

Expression Conditions:

  • Temperature: Lower temperatures (16-25°C) often improve membrane protein folding

  • Induction: Use gradual induction with lower inducer concentrations

  • Media: Enriched media like Terrific Broth can improve yield

  • Growth phase: Induce at mid-log phase (OD600 = 0.6-0.8)

  • Duration: Extended expression times (overnight) at lower temperatures

What are the regulatory requirements for working with recombinant E. coli O127:H6 strains?

Research involving recombinant E. coli O127:H6, particularly pathogenic strains, requires adherence to strict biosafety guidelines and regulatory requirements:

  • Institutional Approval: Prior to initiating work, register your research with your Institutional Biosafety Committee (IBC). Remember that obtaining materials from colleagues does not exempt you from registration requirements .

  • Containment Level: Work with recombinant E. coli O127:H6 typically requires Biosafety Level 2 (BSL-2) containment due to its association with enteropathogenic strains that can cause diarrheal disease .

  • NIH Guidelines Compliance: Follow the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. Based on the experimental design, your research will likely fall under Section III-D or III-F of these guidelines .

  • Documentation Requirements:

    • Detailed protocols for handling the recombinant organisms

    • Risk assessment documentation

    • Standard operating procedures for decontamination and waste disposal

    • Records of personnel training

  • Special Considerations for Pathogenic Strains: Since E. coli O127:H6 is associated with enteropathogenic strains, additional containment measures may be required beyond standard recombinant DNA procedures .

Always consult with your institutional biosafety officer for specific requirements applicable to your research facility.

How can I assess the membrane integration and assembly of recombinant FrdD?

To evaluate membrane integration and proper assembly of recombinant FrdD within the fumarate reductase complex, employ the following methodological approaches:

Membrane Fractionation:

  • Harvest cells and disrupt by French press or sonication

  • Remove unbroken cells by low-speed centrifugation (5,000 × g, 10 min)

  • Separate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

  • Analyze fractions by SDS-PAGE and Western blot using anti-FrdD antibodies

Functional Assembly Assessment:

  • Complementation Assays: Transform frd-deficient strains (like E. coli MI1443) with plasmids containing complete or partial frd operons. Assess growth under anaerobic conditions with glycerol and fumarate as carbon source and electron acceptor, respectively. Complete restoration of growth indicates functional assembly of all subunits .

  • Enzymatic Activity Assays:

    • Benzyl viologen oxidase assay (detects FrdAB activity)

    • Quinol oxidation assays (requires proper assembly of FrdCD membrane anchor)

Blue Native PAGE:
Use blue native PAGE to analyze intact membrane protein complexes without denaturation, allowing visualization of the complete fumarate reductase complex and assessment of proper assembly.

Protease Accessibility Assays:
Treat isolated membrane vesicles with proteases like trypsin or proteinase K. Properly integrated membrane proteins will show a characteristic digestion pattern with protected transmembrane domains.

Research has shown that both FrdC and FrdD are required for membrane association of fumarate reductase and for oxidation of reduced quinone analogues, and separation of their coding sequences affects the ability of the complex to assemble functionally .

What methods can be used to study the electron transfer function of FrdD?

Studying the electron transfer function of FrdD in the fumarate reductase complex requires specialized techniques that probe electron movement through the protein complex:

Quinol Oxidation Assays:

  • Prepare membrane fractions containing assembled fumarate reductase complex

  • Measure oxidation of reduced quinone analogues (e.g., menaquinol, ubiquinol)

  • Monitor spectrophotometrically at 275-290 nm (depends on quinone used)

  • Compare rates between wild-type and mutant forms

Site-Directed Mutagenesis Studies:
Create targeted mutations in conserved residues of FrdD predicted to be involved in quinol binding or electron transfer. For example, mutation studies in other subunits (like Glu-C180 in FrdC) have elucidated critical residues involved in proton-coupled electron transfer . Similar approaches can identify key residues in FrdD.

EPR Spectroscopy:
Electron paramagnetic resonance spectroscopy can detect and characterize paramagnetic centers involved in electron transfer, providing insight into the redox properties of the complex.

Solvent Isotope Effect Analysis:
Comparing enzyme activity in H₂O versus D₂O can help identify rate-limiting proton transfer steps coupled to electron transfer, as demonstrated in studies of the Glu-C180 residue in FrdC .

Midpoint Potential Determination:
Determine the redox midpoint potentials of electron transfer components using techniques such as potentiometric titrations coupled with optical or EPR spectroscopy. Alterations in these potentials can indicate changes in electron transfer efficiency.

These methodologies can reveal how FrdD participates in the electron transfer pathway from quinols to the catalytic site, essential for understanding the mechanistic details of anaerobic respiration in E. coli.

How can I optimize the solubility of recombinant FrdD during purification?

Optimizing solubility of recombinant FrdD, a membrane protein, requires specialized approaches:

Extraction and Solubilization:

  • Select appropriate detergents for membrane protein solubilization:

    • Mild detergents like n-dodecyl-β-D-maltoside (DDM), digitonin, or LMNG

    • Test a panel of detergents at different concentrations (typically 0.5-2% for initial extraction)

    • Include stabilizing agents like glycerol (10-20%) and salt (100-300 mM NaCl)

  • Optimize solubilization conditions:

    • Temperature: Usually 4°C to minimize protein degradation

    • Duration: 1-2 hours with gentle agitation

    • Protein:detergent ratio: Critical for efficient extraction without denaturation

Expression Strategies:

  • Use fusion tags known to enhance membrane protein solubility:

    • MBP (maltose-binding protein)

    • SUMO (small ubiquitin-like modifier)

    • Mistic (membrane-integrating sequence for translation of integral membrane protein constructs)

  • Co-expression approaches:

    • Co-express all four Frd subunits (FrdABCD) simultaneously to promote proper complex formation

    • Express with chaperones like GroEL/GroES to assist correct folding

Purification Considerations:

  • Maintain detergent above critical micelle concentration throughout purification

  • Include lipids (0.01-0.1 mg/mL) to stabilize the protein

  • Use gradient purification with increasing detergent concentrations

  • Consider amphipol or nanodisc technologies for stabilizing membrane proteins in a native-like environment

Research has shown that attempting to purify individual membrane subunits like FrdD separate from their complex partners often leads to instability, as demonstrated by the failure to restore functionality when FrdC and FrdD are expressed from separate plasmids .

What are effective approaches for studying FrdD interactions with other subunits of the fumarate reductase complex?

To investigate the interactions between FrdD and other subunits of the fumarate reductase complex, employ these methodological approaches:

Co-immunoprecipitation (Co-IP):

  • Use antibodies against one subunit (e.g., FrdA or FrdB) to pull down the entire complex

  • Analyze co-precipitated proteins by Western blotting with anti-FrdD antibodies

  • Include appropriate controls (non-specific IgG, lysates from frd knockout strains)

Crosslinking Studies:

  • Use chemical crosslinkers of varying lengths to capture transient interactions

  • Apply membrane-permeable crosslinkers for in vivo studies

  • Identify crosslinked products by mass spectrometry to map interaction interfaces

Bacterial Two-Hybrid System:

  • Construct fusion proteins linking FrdD and potential interaction partners to complementary fragments of adenylate cyclase

  • Transform into appropriate reporter strains

  • Analyze interaction by monitoring reporter gene expression

FRET (Förster Resonance Energy Transfer):

  • Generate fluorescent protein fusions to FrdD and other Frd subunits

  • Express in appropriate E. coli strains

  • Measure energy transfer as indication of protein proximity

Complementation Analysis:
Create a matrix of complementation experiments with different combinations of wild-type and mutant subunits to identify specific residues involved in subunit interactions. Previous research has shown that separation of FrdC and FrdD expression (via separate plasmids) impairs functional assembly, highlighting the importance of coordinated expression for proper interactions .

Protein Fragment Complementation:
Split a reporter protein (e.g., GFP, luciferase) and fuse the fragments to FrdD and potential interaction partners. Reconstitution of fluorescence or enzymatic activity indicates proximity of the proteins.

These approaches can help elucidate the structural basis for the observation that both FrdC and FrdD are required for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues.

How do post-translational modifications affect the function of FrdD in E. coli O127:H6?

Flavinylation:
While FrdD is not directly flavinylated, the catalytic subunit FrdA contains a covalently attached FAD cofactor essential for electron transfer and catalytic activity. Studies in other organisms have shown that flavin transferases like ApbE catalyze the covalent attachment of flavin to specific motifs . The proper flavinylation of FrdA is critical for the function of the entire complex, including the electron transfer role of FrdD.

Methodology to assess impact on FrdD function:

  • Generate mutations in the flavinylation sites of FrdA

  • Express the mutant proteins alongside wild-type FrdBCD

  • Assess complex assembly and membrane association

  • Measure quinol oxidation activity to determine if FrdD function is compromised

Iron-Sulfur Cluster Assembly:
The iron-sulfur clusters in FrdB are essential for electron transfer from FrdCD to FrdA. Defects in iron-sulfur cluster assembly can disrupt electron flow through the complex.

Methodology to study this relationship:

  • Manipulate iron-sulfur cluster assembly using genetic approaches (e.g., deletion of isc or suf genes)

  • Monitor the impact on complex assembly and electron transfer efficiency

  • Assess whether FrdD-mediated quinol oxidation is affected

Phosphorylation:
Potential phosphorylation of FrdD or other subunits might regulate complex activity or assembly.

Experimental approach:

  • Use phosphoproteomic analysis to identify potential phosphorylation sites

  • Create phosphomimetic and phospho-null mutations

  • Assess impact on complex assembly and activity

Understanding these modification-dependent interactions is crucial for fully characterizing the functional role of FrdD within the complex and may provide insights into regulatory mechanisms affecting anaerobic respiration in E. coli O127:H6.

What are the common challenges in distinguishing the specific functions of FrdC versus FrdD, and how can they be addressed?

Distinguishing the specific functions of FrdC versus FrdD presents significant challenges due to their structural and functional similarities as membrane anchor subunits. Here are methodological approaches to address these challenges:

Challenge 1: Functional Redundancy
FrdC and FrdD share similar roles in membrane anchoring and quinol interaction, making it difficult to distinguish their individual contributions.

Methodological solution:

  • Create chimeric proteins by swapping domains between FrdC and FrdD

  • Generate point mutations in conserved versus non-conserved residues

  • Assess function using complementation assays in strains expressing only FrdAB

  • Compare quinol oxidation rates with different quinol substrates to identify subunit-specific preferences

Challenge 2: Co-dependent Assembly
Research has shown that both FrdC and FrdD are required for membrane association and proper complex assembly, complicating isolated study .

Methodological solution:

  • Use conditional expression systems where one subunit can be selectively depleted

  • Employ in vitro translation systems with defined membrane environments

  • Develop split-protein complementation assays specific to each subunit

  • Use quantitative mass spectrometry to monitor assembly intermediates

Challenge 3: Similar Topology and Structure
Both proteins have transmembrane helices with similar arrangements.

Methodological solution:

  • Employ subunit-specific antibodies for immuno-localization studies

  • Use cysteine scanning mutagenesis coupled with accessibility studies

  • Apply crosslinking with mass spectrometry to map subunit-specific interactions

  • Perform molecular dynamics simulations to identify unique structural features

Data Table: Comparative Features of FrdC and FrdD in E. coli

FeatureFrdCFrdDExperimental Method to Distinguish
Size~15 kDa~13 kDaSDS-PAGE/Western blot
Transmembrane helices33Topology mapping with reporter fusions
Quinol interactionPrimary siteSecondary siteSite-directed mutagenesis with activity assays
Interaction with FrdBDirectIndirect via FrdCCrosslinking studies
Evolutionary conservationHigherLowerPhylogenetic analysis

How can the study of FrdD contribute to understanding pathogenic mechanisms in E. coli O127:H6?

E. coli O127:H6 is classified as an enteropathogenic E. coli (EPEC) strain capable of forming attaching and effacing (A/E) lesions on intestinal epithelial cells . Understanding the role of FrdD in this context opens new research directions:

Anaerobic Metabolism During Infection:
Pathogens encounter oxygen-limited environments in the intestine, making fumarate reductase potentially important for virulence. A methodological approach to investigating this connection includes:

  • Generate frdD knockout mutants in E. coli O127:H6

  • Compare growth and survival in anaerobic infection models

  • Assess virulence factor expression under fumarate respiration conditions

  • Perform competition assays between wild-type and frdD mutants in animal models

Integration with Virulence Regulation:
The expression of virulence factors and metabolic genes is often co-regulated in pathogens. To investigate potential regulatory overlap:

  • Perform transcriptomic analysis comparing virulence gene expression in wild-type versus frdD mutants

  • Identify shared regulatory elements between frd operon and virulence genes

  • Use chromatin immunoprecipitation to identify transcription factors binding to both regions

  • Test whether known virulence regulators (e.g., Ler, Per) affect frd expression

Metabolic Adaptation During Host Colonization:
Fumarate reductase activity may provide metabolic flexibility during different stages of infection. To study this:

  • Develop fluorescent reporters for frd operon expression

  • Track expression during different stages of infection in cell culture and animal models

  • Characterize metabolites in intestinal contents of infected animals

  • Test whether host-derived metabolites affect fumarate reductase activity

Understanding these connections could reveal new targets for antivirulence strategies against enteropathogenic E. coli infections, focusing on disrupting metabolic adaptations required for successful colonization and pathogenesis.

What are the applications of recombinant E. coli O127:H6 FrdD in developing new biocatalysts or bioelectrochemical systems?

The unique electron transfer properties of fumarate reductase, including the membrane anchor subunit FrdD, make it promising for biotechnological applications:

Microbial Fuel Cells:
The electron transfer capability of FrdD can be harnessed in bioelectrochemical systems. A methodological approach includes:

  • Express engineered FrdABCD complexes in electroactive organisms

  • Optimize membrane interface with electrodes using nanomaterial conjugation

  • Measure current generation under varying substrate conditions

  • Compare performance with other bacterial terminal reductases

Biocatalysis for Chemical Synthesis:
The fumarate reductase complex catalyzes stereospecific reduction of fumarate to succinate, which can be leveraged for green chemistry applications:

  • Engineer FrdABCD for expression in industrially-relevant strains

  • Test activity with non-natural substrates (other unsaturated dicarboxylic acids)

  • Optimize reaction conditions for maximal conversion efficiency

  • Develop immobilization strategies for continuous flow reactions

Data Table: Potential Biocatalytic Applications of Engineered Fumarate Reductase

SubstrateProductPotential ApplicationEngineering Strategy
FumarateSuccinateBiodegradable polymer precursorWild-type FrdABCD
MaleateSuccinatePharmaceutical intermediateFrdA active site mutations
ItaconateMethylsuccinateSpecialty chemicalExpanded substrate binding pocket
AcrylatePropionateBioplastic precursorFusion with electron donor proteins

Whole-Cell Biocatalysts:
Recombinant E. coli expressing optimized FrdABCD could serve as whole-cell biocatalysts:

  • Engineer cells for increased membrane permeability to target substrates

  • Co-express FrdABCD with complementary enzymes for cascade reactions

  • Develop oxygen-tolerant variants for simplified bioprocessing

  • Create immobilized whole-cell systems for continuous production

These applications demonstrate how fundamental research on FrdD structure and function can be translated into biotechnological innovations, particularly in sustainable chemistry and bioelectrochemical systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.