Recombinant Escherichia coli O127:H6 Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
mscL; E2348C_3553; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
mscL
Target Protein Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LREAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV LLTEIRDLLKEQNNRS
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of the MscL channel in bacteria like E. coli O127:H6?

The MscL (mechanosensitive channel of large conductance) in Escherichia coli O127:H6 serves as a critical pressure-relief valve that protects bacterial cells from lysing during acute osmotic downshock . This protective mechanism is essential for bacterial survival when cells experience rapid transitions from high to low osmolarity environments, a common challenge in their natural habitats.

When bacteria encounter hypoosmotic conditions, water rapidly enters the cell due to the osmotic gradient, causing increased turgor pressure within the cytoplasm. This heightened pressure stretches the cell membrane, which in turn activates the MscL channel . The channel's activation allows for the rapid efflux of cytoplasmic contents, including ions, small metabolites, and even small proteins, thereby relieving excessive turgor pressure and preventing cell lysis.

The MscL channel represents one of the most thoroughly studied mechanosensitive channels in prokaryotes and serves as an excellent model system for investigating the molecular mechanisms of mechanotransduction—the process by which cells convert mechanical stimuli into biological responses . Understanding these mechanisms has broader implications for both microbial physiology and the development of antimicrobial strategies.

What is the conductance and pore size of the MscL channel when activated?

When fully activated in response to increased membrane tension, the MscL channel opens to form a remarkably large, nonselective pore approximately 30 Å in diameter . This substantial pore size makes MscL one of the largest gated channels known in bacteria, allowing for the passage of various cellular contents including ions, metabolites, and even small proteins.

The fully open MscL channel exhibits an exceptionally high unitary conductance of approximately 3 nanosiemens (nS) . This large conductance value reflects the channel's ability to rapidly mediate the efflux of cytoplasmic contents during hypoosmotic stress, efficiently relieving excess turgor pressure and preventing cell lysis.

The nonselective nature of the MscL pore is a key feature of its function as an emergency release valve. Unlike ion-selective channels that discriminate between different ionic species, MscL permits the passage of diverse molecules up to a certain size threshold. This lack of selectivity enables the rapid release of internal pressure through the efflux of whatever solutes are available in the cytoplasm, providing an efficient mechanism for osmoregulation during acute hypoosmotic stress.

How does membrane tension trigger conformational changes in MscL?

The mechanosensing capability of the MscL channel relies on its ability to directly respond to changes in membrane tension without requiring additional cellular components or signaling molecules . This direct mechanism of mechanosensation makes MscL an excellent model system for studying how physical forces can be converted into biological responses at the molecular level.

Membrane tension affects MscL through forces transmitted directly from the lipid bilayer to the channel protein. When the membrane is stretched during hypoosmotic conditions, the resulting increase in lateral tension alters the energetics of protein-lipid interactions . These altered interactions destabilize the closed conformation of the channel, favoring the transition to the open state through a series of intermediate conformations.

Research involving structural analyses of archaeal MscL homologs has provided valuable insights into this process. By comparing structures of the channel in different conformational states, researchers have identified coordinated movements of multiple structural elements that occur during channel gating . These studies have revealed that membrane tension induces specific changes in the tilt angles of transmembrane helices, leading to the formation of the open pore.

The mechanical force transduction process in MscL represents a sophisticated nanoscale valve system that has evolved to respond precisely to a specific range of membrane tensions. The channel remains closed under normal conditions but opens rapidly when tension exceeds a threshold value, providing an elegant solution to the challenge of maintaining cellular integrity during osmotic stress .

What structural rearrangements occur in MscL transmembrane helices during channel opening?

The transition of MscL from the closed to the open state involves substantial conformational changes in its transmembrane domains, particularly in the two transmembrane helices designated TM1 and TM2 . These helices undergo significant reorientations that are critical for channel gating and pore formation.

Structural studies comparing archaeal MscL in closed and expanded intermediate states have revealed that both TM1 and TM2 exhibit marked changes in their tilt angles relative to the membrane plane during channel opening . These observations align well with the helix-pivoting model derived from geometric analyses of previous structures, suggesting that the helices rotate around specific pivot points as they transition between conformational states.

The TM1 helix, which lines the pore in the open state, undergoes particularly dramatic rearrangements. In the closed state, TM1 helices from multiple subunits pack tightly together to form a constriction that prevents ion flow. As membrane tension increases, these helices tilt away from the central axis of the channel, expanding the pore diameter . Concurrent with these movements, the TM2 helices also reorient to accommodate the new positions of TM1 and to maintain critical protein-lipid interactions.

These coordinated conformational changes in the transmembrane domains demonstrate the highly evolved mechanical coupling mechanism that allows MscL to function as an effective pressure-release valve in response to membrane tension .

How do archaeal MscL homologs inform our understanding of E. coli MscL function?

Structural studies of archaeal MscL homologs, particularly from Methanosarcina acetivorans, have provided crucial insights into the mechanosensitive channel function that can be extrapolated to understanding E. coli MscL, including the O127:H6 variant . By solving structures of the archaeal MscL in different conformational states, researchers have been able to visualize the dynamic changes that occur during channel gating.

The archaeal MscL structures have been captured in both closed and expanded intermediate states through innovative approaches involving fusion-protein strategies and careful control of detergent composition . Comparative analysis of these structures has revealed significant conformational rearrangements in different domains of the channel, providing a molecular-level understanding of the gating mechanism.

Key insights from the archaeal MscL structures include the observation of substantial changes in the tilt angles of transmembrane helices and dramatic transformations in the periplasmic loop region . The periplasmic loop transitions from a folded structure with an ω-shape in the closed state to a significantly different configuration in the expanded state, highlighting the coordinated nature of the conformational changes throughout the protein.

These structural insights from archaeal homologs provide a framework for understanding the gating mechanism of E. coli MscL, including the O127:H6 variant. While there may be species-specific differences in channel properties, the fundamental mechanisms of mechanosensation and the coordinated structural rearrangements during gating are likely conserved across bacterial and archaeal MscL channels .

What are the optimal storage and handling conditions for recombinant MscL protein?

Proper storage and handling of recombinant Escherichia coli O127:H6 MscL protein are crucial for maintaining its structural integrity and functional properties during experimental investigations. Based on established protocols, the lyophilized recombinant protein should be stored at -20°C or preferably at -80°C upon receipt . This low-temperature storage helps prevent protein degradation and preserve activity over extended periods.

For working with the protein, it is recommended to aliquot the reconstituted protein to avoid repeated freeze-thaw cycles, which can significantly compromise protein quality . Working aliquots can be stored at 4°C for up to one week, but longer-term storage requires maintaining the samples at -20°C or -80°C .

Storage ConditionTemperatureMaximum DurationNotes
Long-term storage-80°CYearsPreferred for maximum stability
Alternative long-term-20°CMonths to yearsAcceptable alternative
Working aliquots4°CUp to one weekFor active experiments

The recombinant MscL protein is typically supplied in a stabilizing buffer composition consisting of a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . This formulation helps maintain protein stability during storage. Trehalose, a non-reducing disaccharide, is particularly effective at preserving protein structure during lyophilization and subsequent storage by replacing water molecules around the protein and preventing denaturation.

How should recombinant MscL be reconstituted for experimental use?

Proper reconstitution of recombinant Escherichia coli O127:H6 MscL protein is essential for experimental applications, particularly for functional studies of channel activity. The reconstitution process should begin with a brief centrifugation of the protein vial prior to opening to ensure that all lyophilized material is collected at the bottom of the container .

The lyophilized protein should be reconstituted in deionized sterile water to achieve a protein concentration between 0.1 and 1.0 mg/mL . For optimal stability during storage of the reconstituted protein, it is recommended to add glycerol to a final concentration of 5-50%, with 50% being the standard recommendation for maximum protection against freeze-induced denaturation .

For functional studies, the reconstituted MscL protein often needs to be incorporated into artificial membrane systems such as liposomes or lipid bilayers. This typically involves additional steps beyond the initial reconstitution, including detergent-mediated protein incorporation into lipid vesicles followed by detergent removal through dialysis or adsorption to hydrophobic beads.

The reconstitution efficiency can be affected by various factors including lipid composition, protein-to-lipid ratio, detergent type, and reconstitution method. Researchers should optimize these parameters based on their specific experimental objectives and the intended applications of the reconstituted MscL channels.

What expression systems have been successful for producing functional recombinant MscL?

Escherichia coli expression systems have proven highly effective for the production of functional recombinant MscL protein, including the O127:H6 variant . The homologous nature of the expression host when producing E. coli proteins offers advantages in terms of proper folding and post-translational processing, contributing to the production of functionally active channels.

The recombinant MscL protein is typically expressed with an N-terminal histidine tag (His-tag), which facilitates efficient purification through nickel or cobalt affinity chromatography . This approach allows for the isolation of high-purity protein (greater than 90% as determined by SDS-PAGE) suitable for structural and functional studies .

Expression SystemAdvantagesChallengesTypical Yield
E. coli (homologous)Native-like folding, high expression levels, simple cultivationPotential toxicity of overexpressed channel1-5 mg/L culture
E. coli with fusion partnersImproved solubility, simplified purificationMay affect protein function, requires tag removalVaries with fusion partner
Cell-free systemsAvoids toxicity issues, rapid productionLower yields, higher cost0.1-1 mg/mL reaction
Yeast expressionEukaryotic processing, suitable for scale-upGlycosylation differences, lower yields for bacterial proteins0.5-2 mg/L culture

While E. coli is the predominant expression system for MscL production, alternative expression platforms including cell-free systems have also been explored for specific applications, particularly when investigating channel variants that might affect host cell viability when expressed in vivo.

For the Escherichia coli O127:H6 MscL variant specifically, expression in E. coli has yielded full-length protein (136 amino acids) with appropriate folding and membrane localization . The successful expression and purification of this protein enable various downstream applications including structural studies, reconstitution into artificial membrane systems, and functional characterization of channel properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.