Recombinant Escherichia coli O127:H6 NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) and its significance in E. coli O127:H6?

E. coli O127:H6 (strain E2348/69) is particularly important as it serves as a prototype strain for studying EPEC biology, genetics, and virulence mechanisms worldwide . Understanding the structure and function of nuoK in this specific pathotype provides insights into basic bacterial physiology and potentially into the metabolic adaptations that support virulence. While nuoK itself is not a virulence factor, its role in energy metabolism makes it relevant for understanding how pathogenic E. coli maintain cellular energetics during host infection.

How does nuoK structurally integrate within the NADH:quinone oxidoreductase complex?

The nuoK subunit is one of seven membrane subunits (NuoA, NuoH, NuoJ, NuoK, NuoL, NuoM, NuoN) that form the membrane arm of the NADH:quinone oxidoreductase I complex in E. coli . The complete composition of Complex I includes these membrane subunits plus the peripheral arm components (NuoB, NuoC, NuoE, NuoF, NuoG, NuoI), which together form the functional holoenzyme .

NuoK is positioned within the membrane domain and contributes to the proton translocation pathway of Complex I. The protein spans the bacterial inner membrane with multiple transmembrane helices. Based on the amino acid sequence provided in the product information, nuoK is highly hydrophobic, consistent with its membrane-embedded nature: "MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG" . This sequence reveals a protein rich in hydrophobic residues that form transmembrane domains, interspersed with charged residues that likely participate in proton translocation.

Unlike some other subunits of Complex I, nuoK does not contain any cofactors such as iron-sulfur clusters or flavin mononucleotide (FMN), which are present in peripheral arm subunits like NuoF and NuoG . Instead, nuoK's primary role appears to be structural and functional in the context of proton pumping across the membrane during the electron transfer process.

What expression systems are optimal for producing recombinant nuoK protein?

Expressing membrane proteins like nuoK presents significant challenges due to their hydrophobic nature and requirement for proper membrane insertion. Based on available data, E. coli expression systems have been successfully employed for recombinant nuoK production . For research purposes, several considerations must be addressed:

• Expression Vector Selection: For nuoK from E. coli O127:H6, vectors with tightly controlled promoters (such as T7-based expression systems) are preferred to prevent toxicity from overexpression of membrane proteins. The recombinant product described uses an N-terminal His-tag fusion, which facilitates purification while minimizing interference with protein folding .

• Host Strain Optimization: E. coli BL21(DE3) or its derivatives are commonly used for membrane protein expression, including nuoK. These strains lack certain proteases and provide the T7 RNA polymerase necessary for high-level expression from T7 promoters .

• Induction Conditions: Low temperature induction (16-20°C) following the addition of reduced concentrations of IPTG (0.1-0.5 mM) often improves the yield of properly folded membrane proteins by slowing the production rate and allowing time for membrane insertion.

• Media Supplementation: The addition of glucose (0.5-1%) to suppress basal expression and appropriate antibiotics for plasmid maintenance is essential for optimal expression.

For membrane proteins like nuoK, specialized approaches such as using C41(DE3) or C43(DE3) strains (derivatives of BL21(DE3) with adaptations for membrane protein expression) may improve yields of functional protein. Additionally, cell-free expression systems represent an alternative approach for difficult-to-express membrane proteins, allowing direct incorporation into supplied lipid environments.

What are the recommended protocols for purification and reconstitution of recombinant nuoK?

Purification of recombinant nuoK requires specific protocols designed for membrane proteins. Based on the product information provided :

• Membrane Isolation: After expression, bacterial cells should be disrupted (typically via sonication or French press), followed by differential centrifugation to isolate the membrane fraction.

• Detergent Solubilization: The membrane fraction containing nuoK must be solubilized using appropriate detergents. Common choices include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin at concentrations just above their critical micelle concentration.

• Affinity Chromatography: For His-tagged nuoK, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective. Buffers should contain detergent at concentrations above the critical micelle concentration to maintain protein solubility.

• Additional Purification Steps: Size exclusion chromatography may be employed as a final purification step to remove aggregates and ensure homogeneity.

For reconstitution of lyophilized recombinant nuoK, the following protocol is recommended based on the product information :

• Briefly centrifuge the vial containing lyophilized protein to bring contents to the bottom.

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

• Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) for long-term storage.

• Aliquot the reconstituted protein and store at -20°C/-80°C.

• Avoid repeated freeze-thaw cycles, as this can lead to protein denaturation.

For functional studies, reconstitution into proteoliposomes may be necessary. This typically involves mixing the purified protein with phospholipids in the presence of detergent, followed by detergent removal via dialysis or adsorption onto hydrophobic resins.

What biophysical techniques are most effective for analyzing nuoK structure and interactions?

Due to the challenges associated with membrane protein analysis, multiple complementary techniques are recommended for studying nuoK structure and interactions:

For studying protein-protein interactions specifically within the context of Complex I, co-immunoprecipitation experiments using antibodies against the His-tag or nuoK itself can help identify interaction partners. Additionally, bacterial two-hybrid systems modified for membrane proteins can be employed to study specific interactions between nuoK and other complex components.

How can site-directed mutagenesis be applied to study structure-function relationships in nuoK?

Site-directed mutagenesis represents a powerful approach for investigating the functional significance of specific amino acid residues in nuoK. Based on approaches used for other Complex I subunits , the following methodology is recommended:

• Target Residue Selection:

  • Conserved charged residues (Glu, Asp, Lys, Arg) that may participate in proton translocation

  • Highly conserved residues across bacterial species, which often indicate functional importance

  • Residues at predicted subunit interfaces based on structural models

• Mutation Design Strategy:

  • Conservative substitutions (e.g., Glu→Asp) to test the importance of side chain length

  • Charge neutralization (e.g., Glu→Gln) to test the importance of charge

  • Charge reversal (e.g., Glu→Lys) to test the effect of opposite charge

  • Alanine scanning to assess the contribution of specific side chains

• Functional Assays After Mutagenesis:

  • NADH oxidase activity measurements of purified complex containing mutant nuoK

  • Proton pumping efficiency using reconstituted proteoliposomes

  • Growth phenotype analysis under conditions requiring respiratory chain function

  • Assembly state assessment using blue native PAGE

Studies of other NADH:quinone oxidoreductase subunits have employed similar approaches, revealing crucial residues involved in energy transduction. For example, mutagenesis of conserved residues in the NuoCD subunit demonstrated their importance in energy transduction and assembly of Complex I . Similar approaches could identify key functional residues in nuoK.

When designing a mutagenesis study for nuoK, it is instructive to note that studies on other subunits have found that certain conserved acidic residues within transmembrane helices are required for energy transduction, as demonstrated for the third α-helix in the NuoC domain . Analogous conserved residues in nuoK's transmembrane domains would be prime targets for mutagenesis.

How can recombinant nuoK be used to study the complete NADH:quinone oxidoreductase complex?

Recombinant nuoK can serve as a valuable tool for investigating various aspects of the NADH:quinone oxidoreductase complex through several experimental approaches:

• Reconstitution Studies: Purified recombinant nuoK can be combined with other purified subunits to reconstitute the membrane domain or even the entire complex in vitro. This approach allows researchers to study the minimal subunit requirements for functions such as proton pumping or ubiquinone reduction.

• Complementation Experiments: In nuoK knockout strains, introducing plasmids expressing recombinant nuoK (wild-type or mutant versions) can reveal the functional consequences of specific mutations through growth phenotype analysis, especially under conditions where respiratory chain function is essential.

• Structural Probes: Modified versions of nuoK containing chemical probes or fluorescent labels at specific positions can serve as reporters of conformational changes during enzyme turnover when incorporated into the complex.

• Antibody Development: Recombinant nuoK can be used to generate specific antibodies, similar to approaches used for other E. coli proteins . These antibodies are valuable for detection, quantification, and immunoprecipitation experiments to study complex assembly or subunit stoichiometry.

• Cross-linking Studies: Engineered versions of nuoK containing specific cross-linkable residues can help map the proximity of nuoK to other subunits within the assembled complex.

It's worth noting that null mutants of individual nuo genes have been reported to exhibit growth defects under aerobic conditions in rich medium , indicating the importance of each subunit (including nuoK) for proper complex function. This phenotype provides a useful readout for functional complementation studies using recombinant nuoK.

What approaches are effective for studying the role of nuoK in bacterial energy metabolism?

To investigate nuoK's specific contribution to bacterial energy metabolism, researchers can employ several complementary approaches:

• Respiratory Chain Activity Measurements:

  • Oxygen consumption rates using membrane preparations from wild-type and nuoK mutant strains

  • NADH:ubiquinone oxidoreductase activity assays using artificial electron acceptors

  • Measurement of proton pumping efficiency in reconstituted proteoliposomes

• Metabolic Flux Analysis:

  • 13C-labeled substrate tracing to track changes in central metabolic pathways in response to nuoK mutation

  • Measurement of NAD+/NADH ratios to assess the impact on cellular redox state

  • Analysis of ATP/ADP ratios to determine effects on energy charge

• Growth Phenotype Characterization:

  • Comparison of growth rates under different nutrient and oxygen conditions

  • Competition assays between wild-type and nuoK mutant strains to assess fitness

  • Stress response testing (oxidative stress, pH stress) to evaluate the role of nuoK in energy-dependent stress resistance

• Gene Expression Analysis:

  • Transcriptomic profiling to identify compensatory mechanisms activated in response to nuoK disruption

  • qRT-PCR for specific respiratory chain components to detect regulatory adjustments

A particularly informative experimental design would involve comparing the phenotypic consequences of nuoK disruption across different E. coli pathotypes, including the enteropathogenic O127:H6 strain and non-pathogenic laboratory strains, to determine whether pathogenic strains have distinct energy metabolism requirements related to their virulence lifestyle.

How does nuoK from E. coli O127:H6 compare with homologs from other bacterial species?

Comparative analysis of nuoK across different bacterial species provides valuable insights into evolutionary conservation and potential functional specialization. Although the search results don't provide direct comparison data, we can infer several important points based on what is known about Complex I subunits:

The amino acid sequence of E. coli O127:H6 nuoK (MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG) can be compared with nuoK from other bacteria to identify:

• Conserved Motifs: Highly conserved regions likely represent functionally critical domains involved in proton translocation or subunit interactions.

• Taxonomic Variation: Differences between pathogenic and non-pathogenic E. coli strains could suggest adaptations related to the pathogenic lifestyle.

• Evolutionary Rate: The degree of sequence conservation compared to other Complex I subunits can indicate evolutionary constraints and functional importance.

A detailed sequence alignment would typically reveal that membrane subunits of Complex I like nuoK tend to be more conserved across bacterial species than peripheral subunits, reflecting their fundamental role in the proton-pumping machinery. This conservation pattern has been observed in other respiratory complexes and likely applies to nuoK as well.

For a comprehensive evolutionary analysis, researchers should construct phylogenetic trees using nuoK sequences from diverse bacterial species, with special attention to various E. coli pathotypes, to identify potential pathotype-specific adaptations in energy metabolism components.

What is known about nuoK's involvement in stress responses and pathogenicity?

While nuoK itself has not been directly implicated as a virulence factor, the search results provide some relevant context about how NADH:quinone oxidoreductase components may be involved in stress responses:

• Stress-Induced Mutagenesis: Other nuo genes (specifically nuoC and nuoG) have been identified as part of a network of genes that play a role in promoting the stress-induced mutagenesis (SIM) response of E. coli K-12 . This suggests that components of Complex I may have functions beyond energy metabolism, potentially contributing to adaptive responses under stress conditions.

• Organic Solvent Tolerance: NuoG has been implicated in increased organic solvent tolerance mechanisms in crp and cyaA mutants . While this has not been specifically demonstrated for nuoK, it indicates that Complex I components may contribute to stress tolerance phenotypes relevant to bacterial survival in hostile environments.

• Growth Under Stress Conditions: Null mutants of all individual nuo genes show growth defects under aerobic conditions in rich medium , suggesting that intact Complex I function, including the contribution of nuoK, is important for optimal growth even under seemingly favorable conditions.

For enteropathogenic E. coli O127:H6, the prototype strain E2348/69 has been extensively studied for its virulence mechanisms, particularly the type III secretion system and effector proteins . While the direct relationship between nuoK and virulence has not been established, impaired energy metabolism due to nuoK dysfunction could potentially affect the expression or function of virulence factors that require substantial energy investment by the bacterial cell.

Research questions exploring the potential indirect contributions of nuoK to pathogenicity could focus on how energy metabolism impacts the expression and function of established virulence factors in E. coli O127:H6.

What are the common challenges in working with recombinant nuoK and how can they be addressed?

Working with membrane proteins like nuoK presents several technical challenges that researchers should be prepared to address:

• Expression Yield Limitations:

  • Challenge: Low expression levels are common for membrane proteins.

  • Solution: Optimize expression using specialized strains (C41/C43), lower induction temperatures (16-20°C), and reduced inducer concentrations. Consider codon optimization of the nuoK gene for the expression host.

• Protein Aggregation:

  • Challenge: Hydrophobic membrane proteins often aggregate during expression.

  • Solution: Fusion tags that enhance solubility (e.g., MBP, SUMO) can be helpful. The His-tag approach used in the described recombinant product is a standard starting point, but alternative tagging strategies may be needed.

• Detergent Selection:

  • Challenge: Finding detergents that efficiently extract nuoK from membranes while maintaining its native structure.

  • Solution: Screen multiple detergents (DDM, OG, LDAO, etc.) at different concentrations. Mild detergents like DDM are often good starting points for maintaining protein stability.

• Protein Stability:

  • Challenge: Maintaining stability during purification and storage.

  • Solution: The recommended storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0 provides a starting point. Addition of glycerol (5-50%) for long-term storage helps prevent denaturation during freeze-thaw cycles.

• Functional Assays:

  • Challenge: Assessing function of isolated nuoK outside the complex context.

  • Solution: Consider reconstitution into proteoliposomes or nanodiscs to provide a membrane-like environment for functional studies.

• Avoiding Repeated Freeze-Thaw:

  • Challenge: Membrane proteins are particularly sensitive to freeze-thaw damage.

  • Solution: Following the recommendation to store working aliquots at 4°C for up to one week and preparing multiple small aliquots for long-term storage can minimize this issue.

When troubleshooting expression issues, it's worth noting that changes in the expression construct design, such as adjusting the position of the His-tag or including short linkers, can sometimes dramatically improve expression yield and protein stability.

What quality control methods are essential for validating recombinant nuoK preparations?

Ensuring the quality of recombinant nuoK preparations is critical for reliable experimental results. Several complementary quality control methods should be employed:

• Purity Assessment:

  • SDS-PAGE analysis with Coomassie or silver staining (the product information indicates >90% purity by SDS-PAGE)

  • Western blot using anti-His antibodies to confirm the presence of the tagged protein

  • Mass spectrometry for definitive identification and to detect potential degradation products

• Structural Integrity:

  • Circular dichroism spectroscopy to confirm secondary structure content consistent with a membrane protein (predominantly α-helical)

  • Thermal stability assays (e.g., differential scanning fluorimetry) to assess protein folding

  • Size exclusion chromatography to evaluate homogeneity and detect aggregation

• Functional Validation:

  • If studying isolated nuoK: binding assays with known interaction partners

  • If studying reconstituted Complex I: NADH:ubiquinone oxidoreductase activity assays

  • Proteoliposome reconstitution and proton pumping assays for functional assessment

• Biochemical Properties:

  • Detergent micelle size determination by dynamic light scattering

  • Protein concentration determination using methods suitable for membrane proteins (avoid Bradford assay due to detergent interference)

  • Lipid analysis if co-purified lipids are expected to be important for function

A systematic approach to quality control should include documenting batch-to-batch variation in these parameters to establish consistency in preparation methods. For the specific recombinant product described, reconstitution from lyophilized form should be carefully monitored, as improper reconstitution can lead to aggregation or loss of structural integrity.

How should researchers analyze kinetic data from experiments involving recombinant nuoK?

Analyzing kinetic data from experiments involving nuoK requires careful consideration of the protein's role within Complex I and appropriate analytical methods:

• Enzyme Kinetics Analysis:

  • When analyzing NADH:ubiquinone oxidoreductase activity data, standard Michaelis-Menten kinetics can be applied to determine parameters such as Km and Vmax.

  • For inhibition studies, various models (competitive, non-competitive, uncompetitive) should be tested to determine the mechanism of inhibition.

  • Time-dependent inactivation studies can reveal stability under operating conditions.

• Proton Pumping Analysis:

  • Data from proton pumping assays (e.g., using pH-sensitive fluorescent dyes in proteoliposomes) should be analyzed to determine H+/e- ratios.

  • Initial rates should be calculated from the linear portion of progress curves.

  • Control experiments with ionophores (e.g., CCCP) are essential to confirm that observed pH changes are due to vectorial proton transport.

• Statistical Approaches:

  • All kinetic experiments should be performed in at least triplicate to allow statistical analysis.

  • Appropriate statistical tests (t-tests, ANOVA) should be applied to determine the significance of differences observed between wild-type and mutant forms.

  • Error propagation methods should be used when calculating derived parameters.

• Model Fitting:

  • For complex kinetic mechanisms, global fitting of data to multiple models using software like DynaFit or KinTek Explorer provides more robust parameter estimation.

  • Akaike Information Criterion (AIC) or similar metrics can help select the most appropriate kinetic model.

What bioinformatic approaches are most useful for analyzing nuoK sequence and structural data?

Bioinformatic analysis of nuoK can provide valuable insights into its evolution, structure, and function through several key approaches:

• Sequence Analysis:

  • Multiple sequence alignment of nuoK homologs to identify conserved residues using tools like Clustal Omega or MUSCLE

  • Conservation scoring methods (e.g., ConSurf) to map evolutionary conservation onto structural models

  • Coevolution analysis to identify residues that may interact functionally or structurally

  • Phylogenetic analysis to understand evolutionary relationships among nuoK sequences from different bacteria

• Structural Prediction and Analysis:

  • Transmembrane topology prediction using methods like TMHMM or TOPCONS

  • Ab initio or homology-based structural modeling using tools like AlphaFold2 or SWISS-MODEL

  • Molecular dynamics simulations to study conformational dynamics in membrane environments

  • Protein-protein docking simulations to predict interactions with other Complex I subunits

• Functional Site Prediction:

  • Identification of potential proton channels using tools like CAVER

  • Electrostatic surface potential calculation to identify regions involved in proton translocation

  • Prediction of post-translational modification sites that might regulate function

• Comparative Genomics:

  • Analysis of genomic context of nuoK across bacterial species

  • Identification of species- or pathotype-specific variations that might relate to niche adaptation

  • Investigation of selection pressure using dN/dS ratio analysis

A particularly useful bioinformatic approach would be to map the highly conserved residues of nuoK onto a structural model and correlate these with experimental data from mutagenesis studies of related Complex I subunits. This could help identify critical functional regions even in the absence of direct experimental data for nuoK itself.

For the specific amino acid sequence of E. coli O127:H6 nuoK (as provided in the search results) , transmembrane topology prediction would likely reveal multiple membrane-spanning helices, consistent with its role in the membrane arm of Complex I.

How can nuoK research contribute to understanding bacterial respiratory complexes?

Research on nuoK from E. coli O127:H6 can advance our understanding of bacterial respiratory complexes in several important ways:

• Mechanistic Insights: Detailed characterization of nuoK can contribute to resolving the complete proton translocation mechanism of Complex I, which remains one of the central questions in bioenergetics research. The relatively simple structure of bacterial Complex I compared to mitochondrial versions makes it an excellent model system.

• Structure-Function Relationships: Systematic mutagenesis of nuoK combined with functional assays can reveal how specific residues contribute to proton pumping, similar to studies that have been conducted on other subunits like NuoCD where mutagenesis of conserved residues elucidated their roles in ubiquinone binding and enzyme function .

• Evolutionary Context: Comparative analysis of nuoK across bacterial species can provide insights into the evolution of Complex I and how it has adapted to different ecological niches, including pathogenic lifestyles.

• Methodological Advances: Development of expression, purification, and reconstitution methods for nuoK can contribute to the broader field of membrane protein biochemistry, providing techniques applicable to other challenging membrane proteins.

• Integration with Whole-Cell Physiology: Understanding nuoK's role in the context of E. coli energy metabolism can help bridge the gap between molecular mechanisms and cellular phenotypes, particularly in how energy metabolism supports pathogen survival and virulence.

The prototype EPEC strain E2348/69 (serotype O127:H6) has been instrumental in discovering fundamental bacterial virulence mechanisms, including the locus of enterocyte effacement-encoded type III secretion system . Similarly, detailed studies of its energy metabolism components like nuoK could reveal how basic cellular processes are adapted to support pathogenicity.

What are the most promising research directions for future studies on nuoK?

Several promising research directions could significantly advance our understanding of nuoK and its role in bacterial physiology:

The unexpected simplicity of the E2348/69 type III secretion system compared to other pathogenic E. coli strains offers an opportunity to fully dissect virulence strategies in the genomic context . Similarly, systematic comparative studies of respiratory complexes across pathotypes could reveal unexpected adaptations in energy metabolism that support pathogen-specific lifestyles.

Which experimental systems are most appropriate for studying nuoK function in vivo?

Several experimental systems can be employed to study nuoK function in living cells, each with distinct advantages:

For E. coli O127:H6 specifically, which is a well-characterized EPEC strain used in numerous virulence studies , integrated approaches that combine these methods with assessment of virulence factor expression and function would be particularly informative.

How can researchers effectively model nuoK interactions within the NADH:quinone oxidoreductase complex?

Modeling nuoK interactions within the complex requires a multi-faceted approach combining experimental data with computational methods:

• Structural Modeling Approaches:

  • Homology Modeling: Using existing Complex I structures as templates for modeling E. coli O127:H6 nuoK interactions.

  • Molecular Dynamics Simulations: Performing all-atom or coarse-grained simulations of nuoK within a lipid bilayer environment, both in isolation and in the context of neighboring subunits.

  • Protein-Protein Docking: Using computational docking to predict interfaces between nuoK and other Complex I subunits.

• Experimental Validation Methods:

  • Cross-linking: Chemical or photo-crosslinking followed by mass spectrometry to identify residues at subunit interfaces.

  • Mutagenesis of Interface Residues: Systematic mutation of predicted interface residues followed by assembly analysis using techniques like blue native PAGE.

  • Suppressor Mutations: Identifying second-site suppressors that restore function to interface mutants, thereby validating interaction models.

• Reconstitution Approaches:

  • Subcomplex Assembly: Purifying subcomplexes of the membrane domain (including nuoK) to study assembly intermediates.

  • In Vitro Translation: Using cell-free translation systems to co-express interacting subunits and monitor complex formation.

  • Hybrid Complexes: Creating chimeric complexes with subunits from different species to test compatibility and map interaction determinants.

• Functional Readouts for Interaction Quality:

  • Activity Correlation: Correlating assembly state with enzymatic activity to identify critical interactions.

  • Thermal Stability Measurements: Using techniques like differential scanning fluorimetry to assess how mutations affect complex stability.

  • Proteolytic Susceptibility: Comparing proteolytic digestion patterns of wild-type versus mutant complexes to identify structural perturbations.

Based on what is known about Complex I organization, nuoK likely interacts with other membrane subunits such as NuoA, NuoH, NuoJ, and NuoN as part of the membrane arm . The composition of the NADH:quinone oxidoreductase I complex includes these membrane subunits plus the peripheral arm components, forming a specific arrangement critical for electron transfer and proton pumping .

For researchers focused on specific interaction questions, targeted approaches like bacterial two-hybrid systems adapted for membrane proteins or split-protein complementation assays could provide direct evidence for binary interactions between nuoK and other complex components.

What controls are essential when designing experiments involving recombinant nuoK?

Proper experimental controls are crucial for generating reliable and interpretable data when working with recombinant nuoK:

• Expression and Purification Controls:

  • Empty Vector Control: Cells transformed with expression vector without the nuoK gene, processed identically to experimental samples.

  • Inactive Mutant Control: Expression of a known inactive variant of nuoK (e.g., with mutation of essential residues) as a negative control.

  • Tag-Only Control: Expression of the affinity tag alone to control for tag-specific effects.

  • Purification Background Control: Mock purification from cells not expressing nuoK to identify non-specific contaminants.

• Functional Assay Controls:

  • No Protein Control: Assay buffer without added protein to establish baseline.

  • Heat-Inactivated Control: Thermally denatured nuoK to control for non-specific effects.

  • Known Inhibitor Control: Addition of specific Complex I inhibitors to confirm assay specificity.

  • Alternative Substrate Control: Using structural analogs to test substrate specificity.

• Reconstitution Controls:

  • Empty Liposome Control: Liposomes without incorporated protein to assess baseline leakage.

  • Scrambled Orientation Control: Protein incorporated without controlling orientation to assess directional activities.

  • Alternative Detergent Controls: Testing multiple detergents to ensure effects are not detergent-specific.

• Interaction Study Controls:

  • Non-Interacting Protein Control: Using an unrelated membrane protein to control for non-specific interactions.

  • Competition Controls: Using excess unlabeled protein to compete with labeled protein in binding assays.

  • Component Omission Controls: Systematically omitting individual components to verify requirement for each.

• In Vivo Study Controls:

  • Wild-Type Reference: The parent strain without nuoK modifications.

  • Complemented Strain: nuoK knockout complemented with wild-type nuoK to confirm phenotype is specifically due to nuoK loss.

  • Empty Plasmid Control: Strain containing the empty expression vector to control for vector effects.

For product-specific considerations, when using recombinant E. coli O127:H6 nuoK as described in the search results , controls should include verification of protein identity via western blotting or mass spectrometry, and confirmation of proper solubilization and folding before functional studies.

How should researchers plan long-term research projects investigating nuoK function?

Planning a comprehensive research program on nuoK function requires a strategic approach that builds systematically on existing knowledge. A well-designed long-term research plan might include:

• Phase 1: Foundational Characterization (6-12 months)

  • Optimization of expression and purification protocols

  • Basic structural characterization (CD spectroscopy, limited proteolysis)

  • Establishment of functional assays in the context of Complex I

  • Creation of knockout and complementation systems

  • Preliminary bioinformatic analysis to identify conserved features

• Phase 2: Detailed Molecular Analysis (12-24 months)

  • Systematic mutagenesis of conserved residues

  • Detailed characterization of mutant phenotypes (growth, respiration, stress resistance)

  • Protein-protein interaction mapping within Complex I

  • Initial structural studies (cryo-EM of complex, NMR of fragments if feasible)

  • Development of reconstitution systems for functional studies

• Phase 3: Integration with Cellular Physiology (12-24 months)

  • Analysis of metabolic consequences of nuoK mutation (metabolomics, fluxomics)

  • Investigation of potential regulatory roles beyond energy conversion

  • Comparative studies across E. coli pathotypes

  • Assessment of role in stress responses and potential links to virulence

  • Development of small molecule modulators of nuoK function

• Phase 4: Translational Applications (ongoing)

  • Exploration of nuoK as a potential antimicrobial target

  • Development of diagnostic tools based on nuoK characteristics

  • Engineering of nuoK for biotechnological applications

Milestones and Decision Points:

• After Phase 1: Evaluate viability of different approaches based on expression yields and assay robustness

• During Phase 2: Prioritize specific mutations/interactions based on initial results

• Before Phase 3: Reassess focus based on most promising molecular mechanisms identified

• Throughout Phase 4: Continuously evaluate potential applications based on fundamental discoveries

A key consideration for E. coli O127:H6 nuoK research is the integration with existing knowledge about this important EPEC strain. The prototype strain E2348/69 has been used worldwide to study EPEC biology, genetics, and virulence , providing a rich context for understanding how basic cellular processes like energy metabolism interact with pathogenicity mechanisms.