Recombinant Escherichia coli O127:H6 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
aaeA; E2348C_3512; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the molecular function of AaeA in Escherichia coli O127:H6?

AaeA functions as a critical subunit of the p-hydroxybenzoic acid efflux pump system. It forms an efflux pump with AaeB, creating a functional complex that facilitates the elimination of certain compounds, particularly p-hydroxybenzoic acid, when they accumulate to high levels within the bacterial cell. This pump system appears to function as a metabolic relief valve, allowing the bacteria to maintain homeostasis by preventing the toxic accumulation of metabolites or environmental compounds . The protein is alternatively known as pHBA efflux pump protein A, emphasizing its role in the efflux of p-hydroxybenzoic acid .

How should recombinant AaeA be stored to maintain optimal activity?

For optimal storage of recombinant AaeA, the protein should be maintained in a Tris-based buffer containing 50% glycerol, specifically optimized for this protein. Short-term storage can be conducted at -20°C, while for extended preservation, -20°C or -80°C is recommended . For working with the protein, it's advisable to create aliquots to be stored at 4°C for up to one week, as repeated freezing and thawing cycles can significantly compromise protein integrity and functionality . This storage recommendation is critical because membrane proteins like AaeA are particularly susceptible to denaturation during freeze-thaw cycles.

Storage DurationTemperatureBuffer Composition
Short-term (≤ 1 month)-20°CTris-based buffer with 50% glycerol
Long-term (> 1 month)-80°CTris-based buffer with 50% glycerol
Working aliquots (≤ 1 week)4°CTris-based buffer with 50% glycerol

What expression systems are most effective for producing recombinant AaeA?

Based on current research practices, bacterial expression systems, particularly E. coli-based systems, are most commonly used for recombinant AaeA production. The protein can be expressed as a full-length product (amino acids 1-310) . When designing expression constructs, it's important to consider:

  • Codon optimization for E. coli if using a heterologous expression system

  • Appropriate selection of affinity tags that do not interfere with protein folding or function

  • Inclusion of protease cleavage sites if tag removal is necessary for downstream applications

The expression tag type should be carefully determined during the production process to ensure proper protein folding and function . For membrane proteins like AaeA, specialized expression systems that facilitate proper membrane insertion and folding may yield better results than standard cytoplasmic expression systems.

How does AaeA contribute to bacterial stress response mechanisms?

AaeA, as part of the AaeA-AaeB efflux pump system, plays a significant role in bacterial stress response. The efflux system functions as a metabolic relief valve, allowing Escherichia coli to eliminate potentially harmful compounds when they accumulate to high concentrations within the cell . This mechanism is particularly important under environmental stress conditions where toxic metabolites might accumulate.

Research suggests that the regulation of aaeA expression is likely responsive to cellular stress signals, particularly those related to the accumulation of aromatic compounds. Understanding the precise regulatory mechanisms governing AaeA expression provides insights into bacterial adaptation strategies under various environmental conditions.

What is the relationship between AaeA and bacterial pathogenesis in EPEC strains?

The role of AaeA in bacterial pathogenesis, particularly in enteropathogenic Escherichia coli (EPEC) strains like O127:H6, remains an active area of research. While direct evidence linking AaeA to virulence is limited, several hypotheses warrant investigation:

  • The efflux system may contribute to survival in host environments by eliminating host-derived antimicrobial compounds

  • AaeA might indirectly influence the expression of virulence factors by affecting cellular metabolism

  • The efflux system could potentially modulate host-pathogen interactions by eliminating host signaling molecules

The EPEC strain E2348/69 (O127:H6) is known to cause intestinal infections, and understanding the role of efflux systems like AaeA-AaeB in pathogenicity could reveal new therapeutic targets . Studies examining the adherence of EPEC to epithelial cells have provided insights into pathogenic mechanisms, though the specific contribution of AaeA to this process requires further investigation.

How can researchers analyze AaeA expression data across different experimental conditions?

When analyzing AaeA expression data across experimental conditions, researchers should employ a structured approach:

  • Normalization Strategies: Use appropriate housekeeping genes for qRT-PCR data normalization. For protein expression analysis, total protein normalization or reference proteins with stable expression should be employed.

  • Statistical Analysis: Apply ANOVA with post-hoc tests for multiple condition comparisons, or t-tests for pairwise comparisons. Consider non-parametric alternatives when data does not meet normality assumptions.

  • Visualization Techniques: Implement heat maps for expression patterns across multiple conditions and time points. Box plots and violin plots can effectively display distribution characteristics of expression data.

  • Integrated Analysis: Correlate expression data with functional outputs (such as efflux activity measurements) to establish expression-function relationships.

The analytical methods employed should be similar to those used in data analysis for educational research as described in source , which emphasizes the importance of proper visualization and interpretation of research findings.

What bioinformatic approaches can help understand AaeA structure-function relationships?

Several bioinformatic approaches can provide valuable insights into AaeA structure-function relationships:

  • Sequence Alignment and Conservation Analysis: Multiple sequence alignments of AaeA homologs can identify conserved residues likely critical for function. The AaeA sequence (UniProt: B7UJX3) should be aligned with homologs from different bacterial species to identify evolutionary conservation patterns .

  • Structural Prediction and Modeling: Homology modeling using solved structures of related proteins can predict the tertiary structure of AaeA. Transmembrane topology prediction tools can identify membrane-spanning regions crucial for the protein's integration into the cell membrane.

  • Protein-Protein Interaction Prediction: Computational methods can predict interaction interfaces between AaeA and AaeB, guiding site-directed mutagenesis experiments to validate these predictions.

  • Molecular Dynamics Simulations: These can provide insights into conformational changes during substrate transport and interaction with AaeB.

A systematic approach combining these methods creates a comprehensive understanding of how AaeA's structure relates to its function in the efflux pump system.

Why might recombinant AaeA show low activity in experimental systems?

Recombinant AaeA may exhibit low activity in experimental systems due to several factors:

  • Improper Folding: As a membrane protein, AaeA requires a suitable membrane environment for proper folding. Expression in systems lacking appropriate membrane insertion machinery may result in misfolded protein.

  • Absence of Partner Protein: AaeA functions as part of a complex with AaeB . The absence of AaeB in the experimental system may result in reduced or undetectable activity.

  • Buffer Composition: The activity of AaeA is likely sensitive to buffer conditions including pH, ionic strength, and the presence of specific ions that may be required as cofactors.

  • Storage Degradation: Improper storage leading to protein degradation can significantly reduce activity. Adherence to the recommended storage conditions (Tris-based buffer with 50% glycerol at -20°C or -80°C) is essential .

  • Tag Interference: Affinity tags used for purification may interfere with protein function if positioned at critical functional regions.

To troubleshoot low activity issues, researchers should consider expressing AaeA together with AaeB, verify protein integrity through methods such as Western blotting, and optimize buffer conditions through systematic testing.

How can researchers overcome challenges in studying AaeA-AaeB interactions?

Studying the interactions between AaeA and AaeB presents several challenges due to their membrane-bound nature. Researchers can employ the following strategies to overcome these challenges:

  • Co-expression Systems: Simultaneous expression of both AaeA and AaeB in the same system can facilitate proper complex formation. Bacterial dual-expression vectors or bicistronic constructs may be particularly useful.

  • Membrane Mimetics: Utilizing lipid nanodiscs, liposomes, or detergent micelles can provide a suitable membrane-like environment for reconstituting the AaeA-AaeB complex.

  • Cross-linking Approaches: Chemical cross-linking followed by mass spectrometry analysis can identify interacting regions between the two proteins.

  • Proximity Labeling Methods: Techniques such as BioID or APEX2 can identify proteins in close proximity to AaeA in living cells.

  • Split Reporter Systems: Split GFP or split luciferase assays can confirm protein-protein interactions in cellular contexts.

These methodological approaches, combined with careful experimental design and appropriate controls, can provide valuable insights into the functional relationship between AaeA and AaeB in the p-hydroxybenzoic acid efflux pump system.

What are promising areas for future research on AaeA?

Several promising research directions could advance our understanding of AaeA and its role in bacterial physiology:

  • Structural Biology: Determination of the high-resolution structure of the AaeA-AaeB complex would provide unprecedented insights into the mechanism of efflux pump function.

  • Substrate Specificity: Comprehensive characterization of the range of substrates transported by the AaeA-AaeB pump beyond p-hydroxybenzoic acid would clarify its broader physiological roles.

  • Regulatory Networks: Investigation of the transcriptional and post-translational regulation of AaeA expression and activity could reveal how bacteria modulate efflux pump function in response to environmental changes.

  • Role in Antibiotic Resistance: Exploration of whether the AaeA-AaeB pump contributes to intrinsic or acquired antibiotic resistance could have clinical implications.

  • Comparative Studies: Analysis of AaeA homologs across different pathogenic and non-pathogenic E. coli strains could reveal evolutionary adaptations related to different ecological niches.

These research directions build upon current knowledge about AaeA functioning as part of an efflux system that eliminates compounds when they accumulate to high levels in the cell .

How might systems biology approaches enhance our understanding of AaeA function?

Systems biology approaches offer powerful frameworks for understanding AaeA function within the broader context of bacterial physiology:

  • Multi-omics Integration: Combining transcriptomics, proteomics, and metabolomics data can reveal how AaeA expression correlates with global cellular responses and metabolite profiles under various conditions.

  • Network Analysis: Constructing protein-protein interaction networks and gene regulatory networks can position AaeA within broader cellular pathways and identify unexpected functional relationships.

  • Flux Balance Analysis: Mathematical modeling of metabolic fluxes can predict how alterations in AaeA activity might impact cellular metabolism.

  • Single-cell Analysis: Examining cell-to-cell variability in AaeA expression and activity could reveal heterogeneous responses within bacterial populations.

Such integrative approaches, similar to those described for data analysis in educational research , would provide a more comprehensive understanding of how AaeA contributes to bacterial physiology and potentially pathogenesis in E. coli O127:H6.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.