Recombinant Escherichia coli O127:H6 Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributor for specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us. We will prioritize development of the specified tag.
Synonyms
mdoB; opgB; E2348C_4658; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
mdoB
Target Protein Sequence
MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLFASDYFTGDGINDAV LYTLTNSLTGAGVSKYILPGIGIVLGLTAVFGALGWILRRRRRHPHHFGYSLLALLLALG SVDASPAFRQITELVKSQSRDGDPDFAAYYKEPSRTIPDPKLNLVYIYGESLERTYFDNE AFPDLTPELGALKNEGLDFSHTQQLPGTNYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQS FSAVSCSQENIATFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRG DKPQQETLAVKRNTMDNGATVLDILGGDNYLGLGRSSLSGQSMSEIFLNIKEKTLAWKPD IIRLWKFPKEMKEFTIDQQKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQIVQHVDKAIWKGKTAFKD TVIDMARYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKHPLPKKFDLVITAKAYGNNASRPIPVRVGNEEQTLVLGNEVTTTTLHFDNP TDADTLVIVPPEPVSTNEGNILGHSPRKLGIGMVEIKVVEREG
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol transferase I (mdoB) and what is its function in E. coli?

Phosphoglycerol transferase I (mdoB) is an enzyme (EC 2.7.8.20) also known as Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase. This enzyme plays a critical role in the modification of bacterial membrane components and is involved in the synthesis of membrane-derived oligosaccharides (MDOs) in Escherichia coli. The enzyme transfers phosphoglycerol groups from phosphatidylglycerol to these oligosaccharides, which contributes to membrane integrity and cellular adaptation to environmental stresses .

What is the molecular structure of Recombinant E. coli O127:H6 Phosphoglycerol transferase I?

The Recombinant Escherichia coli O127:H6 Phosphoglycerol transferase I (mdoB) is a full-length protein consisting of 763 amino acid residues. The protein contains multiple hydrophobic regions consistent with transmembrane domains, particularly in the N-terminal region, suggesting it is membrane-associated. The enzyme contains crucial catalytic residues including a nucleophilic serine at position 278, which is essential for its enzymatic activity. The complete amino acid sequence provided in the product information demonstrates a complex protein structure with multiple functional domains that facilitate its catalytic activities .

How does the catalytic mechanism of Phosphoglycerol transferase I work?

The catalytic mechanism of Phosphoglycerol transferase I involves a nucleophilic serine residue at position 278, which is critical for enzymatic activity. Experimental evidence shows that mutation of this serine residue (S278A) results in a complete loss of detectable activity, supporting its role as the catalytic nucleophile. The enzyme also contains a conserved histidine residue at position 396, which is also catalytically important. Mutation of this histidine (H396A) leads to significant reductions in activity, with residual esterase activity of 16.6% and transferase activity of 7.0% .

The mechanism likely follows a two-step process:

  • Formation of a phosphoglycerol-enzyme intermediate via the nucleophilic serine

  • Transfer of the phosphoglycerol group to an acceptor substrate (membrane oligosaccharide)

What is the relationship between mdoB and bacterial membrane biology?

Phosphoglycerol transferase I (mdoB) is intimately involved in bacterial membrane biology through its role in modifying membrane-derived oligosaccharides. These modifications affect membrane properties including permeability, fluidity, and surface charge. The enzyme's activity contributes to the structural integrity of the bacterial cell envelope and influences how the bacterium interacts with its environment. In E. coli O127:H6, which is an enteropathogenic strain, these membrane modifications may play roles in adhesion, colonization, and virulence mechanisms .

What expression systems are commonly used for producing Recombinant E. coli O127:H6 Phosphoglycerol transferase I?

The most common expression system for producing Recombinant E. coli O127:H6 Phosphoglycerol transferase I utilizes the pET28a expression vector in E. coli BL21 cells. This system typically includes an N-terminal hexahistidine tag to facilitate purification. For improved expression, researchers often use a truncated version of the protein (such as ΔN variants) that removes hydrophobic transmembrane domains while retaining the catalytic C-terminal domain. The expression protocol generally involves:

  • Cloning the mdoB gene into the pET28a vector using appropriate restriction sites (such as NdeI and XhoI)

  • Transformation into expression hosts like E. coli BL21

  • Induction of protein expression

  • Purification using nickel affinity chromatography, taking advantage of the hexahistidine tag

How do specific mutations in the mdoB gene affect enzyme activity and substrate specificity?

Specific mutations in the mdoB gene can dramatically alter enzyme activity and substrate specificity of Phosphoglycerol transferase I. Research has demonstrated that the serine residue at position 278 (Ser278) is absolutely critical for catalytic activity. Mutation of this residue to alanine (S278A) completely abolishes both esterase and transferase activities. Statistical analysis shows no significant difference between the S278A mutant and enzyme-free controls (t-tests, t(4) = 0.3586 and p = 0.7830 for esterase; t(4) = 0.4935 and p = 0.6475 for transferase) .

Similarly, the conserved histidine at position 396 (His396) plays an important but not absolute role in catalysis. The H396A mutation results in residual activities of 16.6% (esterase) and 7.0% (transferase) compared to the wild-type enzyme. This suggests that while His396 is important for optimal catalysis, it may not be directly involved in the chemical mechanism to the same extent as Ser278 .

The following table summarizes the effects of key mutations on enzyme activity:

MutationResidual Esterase Activity (%)Residual Transferase Activity (%)Statistical Significance
Wild-type100100Reference
S278A00p < 0.001
H396A16.67.0p < 0.01

What are the structural determinants of substrate recognition by Phosphoglycerol transferase I?

The structural determinants of substrate recognition by Phosphoglycerol transferase I involve multiple domains and specific amino acid residues. The catalytic domain, located in the C-terminal region of the protein, contains the active site with the nucleophilic Ser278 and the important His396 residue. The enzyme likely has specific binding pockets or surfaces that recognize both the phosphatidylglycerol donor substrate and the oligosaccharide acceptor.

Based on sequence analysis and structural predictions, several conserved regions in the C-terminal domain (approximately from Ala164 to Gln559) appear to be involved in substrate binding and catalysis. These include:

  • A nucleophilic elbow containing the catalytic serine

  • Positively charged residues that may interact with the phosphate groups

  • Hydrophobic patches that can accommodate the lipid portions of substrates

  • Polar residues that form hydrogen bonds with the carbohydrate acceptors

Studies of related enzymes suggest that specific loops and secondary structural elements create a binding site architecture that positions substrates for optimal catalytic transfer of the phosphoglycerol group .

How do environmental factors affect the expression and activity of mdoB in E. coli?

Environmental factors significantly influence both the expression and activity of mdoB in E. coli. These factors include:

  • Osmotic stress: Membrane-derived oligosaccharides modified by mdoB play a role in osmoregulation. Under low osmolarity conditions, expression of mdoB may be upregulated to increase the production of modified oligosaccharides in the periplasmic space.

  • Growth phase: Expression patterns often vary between exponential and stationary growth phases, with potential upregulation during transitions to stationary phase when cell envelope modifications become more critical.

  • Temperature: Both enzyme activity and expression levels are temperature-dependent, with potential thermal regulation mechanisms affecting protein folding and catalytic efficiency.

  • pH: Environmental pH impacts both gene expression regulation and the ionization state of catalytic residues, affecting the enzyme's activity profile.

  • Nutrient availability: Limitations in phosphate or carbon sources can alter expression patterns of cell envelope modification enzymes, including mdoB.

Understanding these environmental triggers provides insight into the physiological role of Phosphoglycerol transferase I in bacterial adaptation and survival strategies .

What are the optimal conditions for expressing and purifying Recombinant E. coli O127:H6 Phosphoglycerol transferase I?

The optimal conditions for expressing and purifying Recombinant E. coli O127:H6 Phosphoglycerol transferase I involve several key considerations:

Expression conditions:

  • Vector system: pET28a expression vector with NdeI and XhoI restriction sites

  • Host strain: E. coli BL21 for high-level protein expression

  • Induction parameters: Typically IPTG at 0.5-1.0 mM, when cultures reach OD600 of 0.6-0.8

  • Temperature: Often reduced to 18-25°C after induction to improve protein folding

  • Duration: 16-18 hours for optimal protein accumulation

Purification protocol:

  • Cell lysis: Sonication or pressure-based disruption in appropriate buffer

  • Initial capture: Nickel affinity chromatography utilizing the N-terminal hexahistidine tag

  • Additional washing steps: Implement as necessary to achieve homogeneity

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Storage: Short-term at 4°C (up to one week); long-term at -20°C or -80°C with caution against repeated freeze-thaw cycles

Researchers should take care to use new chromatography media for each variant to prevent enzyme carryover and cross-contamination of assay data .

What analytical methods are most effective for characterizing the structural properties of Phosphoglycerol transferase I?

Multiple analytical methods are effective for characterizing the structural properties of Phosphoglycerol transferase I, each providing complementary information:

Combining these methods creates a comprehensive structural profile that informs understanding of Phosphoglycerol transferase I function and mechanism .

What enzyme assays can be used to measure Phosphoglycerol transferase I activity?

Several enzyme assays can be employed to measure Phosphoglycerol transferase I activity, each with specific advantages:

  • Esterase activity assay: Measures the hydrolysis of phosphatidylglycerol when bulk solvent serves as the pEtN acceptor. This assay is simpler but does not directly measure the transferase function.

  • Transferase activity assay: Monitors the transfer of phosphoglycerol groups to defined carbohydrate acceptors, providing a more physiologically relevant measure of activity.

  • Coupled enzyme assays: Links mdoB activity to the production or consumption of a spectroscopically detectable product through secondary enzyme reactions.

  • Radiolabeled substrate assays: Uses 32P- or 14C-labeled phosphatidylglycerol to track the transfer of phosphoglycerol groups with high sensitivity.

  • HPLC-based assays: Separates and quantifies reaction products to determine enzyme kinetics and substrate specificity.

  • Mass spectrometry-based assays: Directly identifies and quantifies modified oligosaccharide products with high specificity.

The choice of assay depends on the specific research question, available equipment, and desired sensitivity. For mutation studies, comparing both esterase and transferase activities provides complementary information about the catalytic mechanism .

What are the key considerations for designing site-directed mutagenesis experiments to study Phosphoglycerol transferase I function?

When designing site-directed mutagenesis experiments to study Phosphoglycerol transferase I function, researchers should consider:

  • Target residue selection:

    • Conserved residues identified through sequence alignment

    • Predicted catalytic residues (e.g., Ser278, His396)

    • Residues in putative substrate binding sites

    • Residues at domain interfaces

  • Mutation type selection:

    • Conservative substitutions to maintain structure but alter function

    • Alanine scanning to remove side chain functionality

    • Introduction of charged residues to test electrostatic interactions

    • Cysteine substitutions for subsequent chemical modification

  • Control mutations:

    • Include mutations in non-conserved, surface-exposed residues as controls

    • Generate catalytically inactive variants (e.g., S278A) as negative controls

  • Validation strategy:

    • Verify correct protein folding (CD spectroscopy, thermal stability)

    • Confirm expression levels comparable to wild-type

    • Assess multiple aspects of enzyme function (both esterase and transferase activities)

    • Perform statistical analysis to determine significance of activity changes

  • Experimental design considerations:

    • Use standardized expression and purification protocols

    • Employ fresh chromatography media for each variant to prevent cross-contamination

    • Include appropriate replicates for statistical analysis

    • Test activity under various conditions to fully characterize mutant properties

These considerations ensure that mutagenesis experiments yield meaningful insights into structure-function relationships of Phosphoglycerol transferase I .

How can isotope labeling be used to study the reaction mechanism of Phosphoglycerol transferase I?

Isotope labeling provides powerful insights into the reaction mechanism of Phosphoglycerol transferase I through several complementary approaches:

  • Kinetic isotope effects (KIEs):

    • Using deuterium-labeled substrates to identify rate-limiting steps

    • 18O-labeled substrates to track oxygen atom transfer during catalysis

    • Measuring primary KIEs on bonds being broken/formed in the transition state

  • Positional isotope exchange (PIX):

    • Using 18O-labeled phosphate groups to determine if phosphoenzyme intermediates form

    • Tracking reversal of the first half-reaction before product formation

  • NMR studies with isotope-labeled proteins or substrates:

    • 15N/13C-labeled enzyme for structural and dynamic studies

    • 31P-NMR to monitor phosphoglycerol transfer directly

    • Following reaction progress in real-time with labeled substrates

  • Mass spectrometry with isotope-labeled substrates:

    • Determining incorporation patterns in products

    • Measuring isotope scrambling to detect multiple reaction pathways

    • Quantifying product formation with high sensitivity

  • Neutron diffraction of crystallized enzyme-substrate complexes:

    • Using deuterium labeling to visualize hydrogen positions

    • Identifying hydrogen bonding networks in the active site

These isotope labeling approaches can reveal:

  • Whether the reaction proceeds through covalent enzyme intermediates

  • The order of substrate binding and product release

  • The role of specific catalytic residues in bond formation/breakage

  • Potential concerted or stepwise transfer mechanisms

By combining multiple isotope labeling strategies, researchers can construct a detailed mechanism for Phosphoglycerol transferase I catalysis .

How should researchers design experiments to compare wild-type and mutant forms of Phosphoglycerol transferase I?

Researchers comparing wild-type and mutant forms of Phosphoglycerol transferase I should implement a comprehensive experimental design:

  • Protein preparation standardization:

    • Use identical expression conditions for all variants

    • Verify protein purity by SDS-PAGE (>95% homogeneity)

    • Quantify protein concentration using consistent methods

    • Confirm proper folding through circular dichroism or thermal shift analysis

  • Activity assessment framework:

    • Evaluate both esterase and transferase activities

    • Determine full kinetic parameters (kcat, Km) rather than single-point measurements

    • Test multiple substrate concentrations to generate Michaelis-Menten curves

    • Include appropriate controls (no enzyme, known inactive mutants)

  • Statistical design considerations:

    • Perform at least triplicate measurements of all activities

    • Calculate standard deviations and conduct appropriate statistical tests

    • Use t-tests to evaluate significance of differences between variants

    • Apply multiple comparison corrections when testing several mutants

  • Environmental variable testing:

    • Assess activity across pH range (6.0-9.0) to identify shifts in pH optima

    • Determine temperature dependence (15-45°C)

    • Evaluate salt/ion requirements or inhibition effects

    • Test substrate specificity with multiple acceptor molecules

  • Structural confirmation:

    • Circular dichroism to confirm secondary structure is maintained

    • Thermal denaturation to assess stability changes

    • Limited proteolysis to detect major conformational alterations

This systematic approach ensures meaningful comparisons between enzyme variants and facilitates reliable interpretation of structure-function relationships .

What are the best methods for studying the interaction between Phosphoglycerol transferase I and its substrates?

The best methods for studying interactions between Phosphoglycerol transferase I and its substrates include:

  • Enzyme kinetics approaches:

    • Steady-state kinetics to determine Km and kcat values

    • Product inhibition studies to elucidate binding order

    • Dead-end inhibitor analysis to probe binding site specificity

    • Pre-steady-state kinetics to identify transient intermediates

  • Biophysical interaction methods:

    • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Microscale thermophoresis (MST) for measuring interactions in solution

    • Fluorescence-based assays (if intrinsic tryptophan or labeled substrates)

  • Structural biology techniques:

    • X-ray crystallography with substrate analogs or inhibitors

    • NMR spectroscopy to identify residues involved in substrate binding

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • Computational docking validated by experimental constraints

  • Chemical biology approaches:

    • Photoaffinity labeling with substrate analogs

    • Activity-based protein profiling with mechanism-based probes

    • Chemical cross-linking of enzyme-substrate complexes

    • Substrate analogs with reporting groups (fluorescent, spin labels)

  • Competition assays:

    • Testing structural analogs to map binding site requirements

    • Determining specificity constants for different substrates

    • Measuring inhibition patterns with substrate variants

These complementary approaches provide a comprehensive understanding of molecular recognition and catalytic mechanisms in Phosphoglycerol transferase I .

How can researchers effectively study the role of Phosphoglycerol transferase I in bacterial membrane biology?

To effectively study the role of Phosphoglycerol transferase I in bacterial membrane biology, researchers should employ a multifaceted approach:

  • Genetic manipulation strategies:

    • Gene knockout/knockdown studies with phenotypic analysis

    • Complementation with wild-type or mutant versions

    • Controlled expression systems to modulate enzyme levels

    • CRISPR-Cas9 gene editing for precise chromosomal modifications

  • Membrane composition analysis:

    • Lipidomics to quantify changes in phospholipid profiles

    • Mass spectrometry of membrane-derived oligosaccharides

    • NMR analysis of membrane components

    • Thin-layer chromatography for rapid screening

  • Membrane property investigations:

    • Fluorescence anisotropy to measure membrane fluidity

    • Differential scanning calorimetry for phase transition analysis

    • Atomic force microscopy to examine nanoscale membrane structure

    • Electrophysiology to assess membrane permeability

  • Functional assays for membrane-dependent processes:

    • Osmotic stress response measurements

    • Antibiotic susceptibility testing

    • Biofilm formation quantification

    • Bacterial adhesion to relevant surfaces

  • Visualization techniques:

    • Fluorescent membrane dyes to track changes in membrane domains

    • Electron microscopy to examine membrane ultrastructure

    • Super-resolution microscopy with labeled membrane components

    • Live-cell imaging to monitor dynamic membrane processes

  • Systems biology integration:

    • Transcriptomics to identify coordinated expression patterns

    • Proteomics of membrane fractions

    • Metabolomics focused on membrane-related pathways

    • Network analysis linking mdoB to broader cellular processes

This comprehensive approach connects molecular-level enzyme function to cellular-level membrane biology and organism-level phenotypes .

What high-throughput screening approaches can be used to identify inhibitors of Phosphoglycerol transferase I?

Several high-throughput screening approaches can effectively identify inhibitors of Phosphoglycerol transferase I:

  • Enzymatic activity-based screens:

    • Colorimetric or fluorometric detection of enzymatic products

    • Coupled enzyme assays that amplify signal detection

    • FRET-based assays monitoring substrate proximity changes

    • Homogeneous time-resolved fluorescence (HTRF) assays

  • Binding-based screens:

    • Thermal shift assays (differential scanning fluorimetry)

    • Surface plasmon resonance (SPR) fragment screening

    • Affinity selection mass spectrometry (ASMS)

    • NMR-based fragment screening (STD-NMR, HSQC)

  • Cellular phenotypic screens:

    • Bacterial growth inhibition in mdoB-dependent conditions

    • Reporter systems linked to membrane stress responses

    • Microscopy-based detection of membrane integrity changes

    • Biofilm formation inhibition assays

  • Virtual screening approaches:

    • Structure-based virtual screening against enzyme active site

    • Pharmacophore modeling based on known substrates

    • Molecular dynamics simulations to identify allosteric sites

    • Machine learning models trained on preliminary screening data

  • Design considerations for compound libraries:

    • Fragment-based approaches for initial hits

    • Focused libraries based on substrate analogues

    • Diversity-oriented libraries to explore chemical space

    • Natural product collections with membrane-active compounds

The following table outlines key parameters for primary screening assays:

Screening ApproachThroughputHit RateAdvantagesLimitations
Enzymatic activityVery high (>100K compounds)0.1-1%Direct measure of inhibitionPotential interference from compounds
Thermal shiftHigh (10-50K compounds)1-5%Simple, low enzyme requirementIndirect measure of binding
SPR/bindingMedium (5-10K compounds)2-10%Direct binding kineticsRequires immobilized protein
Virtual screeningUltra-high (millions)5-20%No physical compounds needed initiallyRequires structural information
PhenotypicMedium-high0.05-0.5%Identifies cell-active compoundsTarget specificity confirmation needed

Subsequent validation of hits should include dose-response curves, binding affinity determination, mechanism of action studies, and selectivity profiling .

How can computational approaches aid in understanding Phosphoglycerol transferase I structure and function?

Computational approaches provide valuable insights into Phosphoglycerol transferase I structure and function through multiple complementary methods:

  • Homology modeling and structural prediction:

    • Generation of 3D structural models based on related enzymes

    • Refinement through molecular dynamics simulations

    • Validation using experimental constraints

    • Identification of catalytic residues and binding pockets

  • Molecular dynamics simulations:

    • Examination of protein flexibility and conformational changes

    • Investigation of water and ion interactions in the active site

    • Characterization of membrane association dynamics

    • Assessment of how mutations affect protein stability and dynamics

  • Quantum mechanics/molecular mechanics (QM/MM):

    • Detailed modeling of chemical reaction mechanisms

    • Calculation of transition state energetics

    • Prediction of catalytic rates for wild-type and mutant enzymes

    • Elucidation of proton transfer pathways

  • Molecular docking and virtual screening:

    • Prediction of substrate binding modes and affinities

    • Identification of potential inhibitor binding sites

    • Screening of virtual compound libraries

    • Structure-based design of selective inhibitors

  • Bioinformatics analyses:

    • Sequence conservation analysis across bacterial species

    • Coevolution analysis to identify functionally coupled residues

    • Genomic context analysis to identify functional partners

    • Phylogenetic analysis to trace evolutionary relationships

  • Machine learning applications:

    • Prediction of enzymatic properties from sequence data

    • Classification of substrate specificity determinants

    • Identification of novel inhibitor scaffolds

    • Integration of diverse experimental datasets

These computational approaches work synergistically with experimental methods to accelerate understanding of Phosphoglycerol transferase I and guide targeted experiments for validation of computational predictions .

What statistical methods are most appropriate for analyzing enzyme kinetic data for Phosphoglycerol transferase I?

The most appropriate statistical methods for analyzing enzyme kinetic data for Phosphoglycerol transferase I include:

  • Regression analysis for parameter estimation:

    • Non-linear regression for direct fitting of Michaelis-Menten equation

    • Linearization methods (Lineweaver-Burk, Eadie-Hofstee) for visual inspection

    • Global fitting for multiple datasets with shared parameters

    • Weighted regression to account for heteroscedasticity in enzymatic assays

  • Error analysis and uncertainty quantification:

    • Standard error calculation for kinetic parameters

    • Confidence interval determination (95% typically reported)

    • Propagation of error when calculating derived parameters

    • Bootstrap resampling for robust parameter distribution estimation

  • Statistical hypothesis testing:

    • t-tests for comparing kinetic parameters between enzyme variants

    • ANOVA for comparing multiple conditions or enzyme forms

    • Multiple comparison corrections (Bonferroni, Holm-Sidak) when appropriate

    • F-test for comparing nested models of enzyme mechanisms

  • Model selection criteria:

    • Akaike Information Criterion (AIC) for comparing non-nested models

    • Residual analysis to assess systematic deviations from models

    • R² and adjusted R² for goodness-of-fit evaluation

    • Cross-validation for testing predictive performance

  • Specialized enzymatic data analysis:

    • Dixon and Cornish-Bowden plots for inhibition mechanism determination

    • Progress curve analysis for time-course measurements

    • Isotope effect data analysis for mechanistic insights

    • Hill equation fitting for cooperative behavior assessment

When reporting statistical analysis results for Phosphoglycerol transferase I studies, researchers should clearly state the statistical methods used, significance levels, and software packages employed for calculations .

How can researchers effectively integrate structural and functional data to understand Phosphoglycerol transferase I mechanisms?

Effective integration of structural and functional data for understanding Phosphoglycerol transferase I mechanisms requires a systematic approach:

  • Structure-function mapping framework:

    • Correlate specific structural elements with measured activities

    • Map mutations onto 3D structures to visualize functional hotspots

    • Identify structural changes associated with different catalytic states

    • Connect evolutionary conservation patterns with functional importance

  • Integrated visualization approaches:

    • Create heat maps of functional data displayed on structural models

    • Generate structure-based sequence alignments annotated with functional data

    • Develop interactive visualizations linking structural features to kinetic parameters

    • Use molecular graphics to highlight mechanistically important interactions

  • Multidimensional data integration:

    • Combine spectroscopic, kinetic, and structural measurements

    • Correlate biophysical properties with functional outcomes

    • Link computational predictions with experimental validation

    • Integrate data across different time and length scales

  • Mechanism hypothesis development and testing:

    • Formulate mechanism hypotheses based on integrated data

    • Design critical experiments to distinguish between alternative mechanisms

    • Iteratively refine mechanistic models based on new data

    • Develop quantitative models that predict functional outcomes

  • Documentation and reporting strategies:

    • Create concept-evidence tables that link theoretical concepts with supporting data

    • Develop typologically ordered tables comparing different mechanistic models

    • Generate theoretical summaries that synthesize insights across datasets

    • Design temporally ordered tables showing reaction progression

This integrated approach should follow qualitative research trustworthiness principles, utilizing tables to organize, analyze, and display evidence in a way that is succinct and convincing to readers .

What approaches can be used to analyze the impact of Phosphoglycerol transferase I on bacterial membrane composition?

To analyze the impact of Phosphoglycerol transferase I on bacterial membrane composition, researchers can employ several complementary approaches:

  • Comparative lipidomics and glycomics:

    • Liquid chromatography-mass spectrometry (LC-MS) for comprehensive profiling

    • Nuclear magnetic resonance (NMR) for structural characterization

    • Thin-layer chromatography (TLC) for rapid screening

    • Gas chromatography-mass spectrometry (GC-MS) for fatty acid analysis

  • Data analysis framework:

    • Multivariate statistical methods (PCA, PLS-DA) for pattern recognition

    • Targeted and untargeted metabolomics approaches

    • Time-series analysis to track dynamic changes

    • Statistical comparison between wild-type and mutant strains

  • Structural characterization of modified components:

    • Tandem mass spectrometry for detailed structural elucidation

    • Multi-dimensional NMR for complete conformational analysis

    • Chemical derivatization strategies for specific functional groups

    • Enzymatic digestion coupled with analytics for complex structures

  • Visualization and bioinformatics:

    • Heat maps for displaying compositional changes

    • Network analysis for connecting related metabolites

    • Pathway enrichment analysis to identify affected biosynthetic routes

    • Machine learning for pattern recognition in complex datasets

  • Integration with phenotypic data:

    • Correlation analysis between membrane composition and phenotypic traits

    • Regression models linking specific modifications to functional outcomes

    • Systems biology approaches connecting genotype, membrane composition, and phenotype

    • Cross-comparison between multiple bacterial strains or growth conditions

This analytical framework provides a comprehensive understanding of how Phosphoglycerol transferase I activity shapes membrane composition and ultimately influences bacterial physiology and pathogenicity .

How can researchers determine the physiological significance of Phosphoglycerol transferase I activity in bacterial systems?

Determining the physiological significance of Phosphoglycerol transferase I activity in bacterial systems requires a multifaceted approach:

  • Genetic manipulation studies:

    • Generation of clean deletion mutants (ΔmdoB)

    • Complementation with wild-type and catalytically inactive variants

    • Construction of conditional expression systems

    • CRISPR interference for tunable gene repression

  • Phenotypic characterization under relevant conditions:

    • Growth curve analysis under various osmotic conditions

    • Survival during environmental stress challenges

    • Biofilm formation capacity quantification

    • Antibiotic susceptibility profiling

  • Physiological response measurements:

    • Membrane permeability assessment

    • Membrane potential monitoring

    • Cell envelope stress response activation

    • Osmoregulation capacity evaluation

  • In vivo molecular analyses:

    • Transcriptomics to identify compensatory responses

    • Proteomics focusing on membrane and envelope proteins

    • Metabolomics targeting osmoregulatory compounds

    • In vivo crosslinking to identify interaction partners

  • Host-pathogen interaction studies (for pathogenic strains):

    • Adhesion and invasion assays with host cells

    • Persistence in infection models

    • Immune response elicitation

    • Virulence factor expression and activity

  • Data analysis and integration framework:

    • Principal component analysis to identify major phenotypic patterns

    • Correlation analysis between molecular and phenotypic data

    • Network analysis to position mdoB in cellular response networks

    • Comparative analysis across growth conditions and bacterial strains

The following table illustrates how to organize and interpret phenotypic data:

Phenotypic TraitWild-typeΔmdoBComplementedCatalytic MutantPhysiological Implication
Growth in high osmolarity++++++++Essential for osmoadaptation
Biofilm formation++++++++Required for matrix modification
Antibiotic resistance++++++++++Contributes to envelope integrity
Membrane permeability++++++++Maintains permeability barrier
Stress response activation++++++++Prevents envelope stress

This comprehensive approach reveals the physiological roles of Phosphoglycerol transferase I beyond its biochemical function, establishing its importance in bacterial adaptation and survival strategies .

What are the best practices for reporting and publishing research on Phosphoglycerol transferase I?

Best practices for reporting and publishing research on Phosphoglycerol transferase I include:

  • Comprehensive methodology documentation:

    • Provide complete gene and protein sequences with accession numbers

    • Detail expression and purification protocols with buffer compositions

    • Describe enzyme assay conditions with all relevant parameters

    • Include statistical analysis methods with appropriate software citations

  • Results presentation guidelines:

    • Present enzyme kinetic data in both tabular and graphical formats

    • Include representative images of gels, chromatograms, and other primary data

    • Provide complete datasets for all replicate experiments

    • Use appropriate statistical measures (means, standard deviations, p-values)

  • Structured data presentation:

    • Utilize data sources tables to document all experimental materials

    • Create concept-evidence tables linking theoretical concepts with supporting data

    • Develop typologically ordered tables comparing different enzyme forms

    • Generate theoretical summaries synthesizing insights across experiments

  • Visual representation standards:

    • Include structural figures with clearly labeled catalytic residues

    • Present reaction schemes showing proposed mechanisms

    • Use consistent color coding across different figure types

    • Provide both simplified schematics and detailed molecular representations

  • Data validation and reproducibility measures:

    • Describe controls for enzyme activity, purity, and specificity

    • Report replicate numbers and experimental variability

    • Provide validation across multiple experimental approaches

    • Deposit raw data in appropriate repositories

  • Contextual integration:

    • Relate findings to broader bacterial physiology

    • Compare results with related enzymes and other bacterial species

    • Discuss implications for antimicrobial development when relevant

    • Connect molecular findings to cellular and organismal phenotypes

Following these reporting practices enhances transparency, reproducibility, and trustworthiness in qualitative research, while effectively communicating complex scientific findings to the research community .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.