Recombinant Escherichia coli O127:H6 Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Description

General Information

Escherichia coli (E. coli) O127:H6 is a serotype of E. coli that includes the strain E2348/69, a prototype strain for studying enteropathogenic E. coli (EPEC) . EPEC strains like E2348/69 are known to cause diarrheal diseases, particularly in infants, through a process called attaching and effacing (A/E) lesion formation on intestinal epithelial cells . This process involves a type III secretion system (T3SS) encoded by the locus of enterocyte effacement (LEE) . The T3SS injects effector proteins into host cells, leading to cytoskeletal rearrangements and the formation of pedestals upon which the bacteria attach .

The potassium-transporting ATPase C chain (KdpC) is a component of the KdpABC complex, a high-affinity potassium transport system in E. coli . This system is essential for maintaining potassium homeostasis, which is crucial for various cellular functions, including enzyme activity, protein synthesis, and osmotic regulation .

Recombinant KdpC refers to the protein produced using recombinant DNA technology, where the gene encoding KdpC is cloned and expressed in a host organism, often to produce large quantities of the protein for research or industrial purposes .

Structure and Function of KdpC

The KdpABC complex is an ATP-dependent potassium transporter that belongs to the P-type ATPase superfamily . It consists of three subunits: KdpA, KdpB, and KdpC.

  • KdpA: A transmembrane protein that forms the channel through which potassium ions are transported.

  • KdpB: The catalytic subunit that hydrolyzes ATP to provide the energy for potassium transport.

  • KdpC: A small, hydrophobic protein that associates with the KdpAB complex and is essential for its stability and function.

KdpC is thought to play a role in stabilizing the KdpABC complex and modulating its activity. While the exact mechanism is not fully understood, studies have shown that the absence of KdpC can lead to a significant reduction in potassium transport activity.

Role in Virulence and Pathogenesis

While KdpC is primarily involved in potassium transport, its role in bacterial virulence and pathogenesis cannot be overlooked. Here’s how KdpC and potassium transport influence bacterial virulence:

  1. Osmotic Stress Response: During infection, bacteria encounter various stresses, including osmotic stress. The Kdp system helps maintain potassium homeostasis, which is essential for survival under these conditions.

  2. Regulation of Virulence Genes: Potassium levels can influence the expression of virulence genes. The Kdp system may indirectly affect virulence by modulating intracellular potassium concentrations.

  3. Biofilm Formation: Potassium transport has been shown to play a role in biofilm formation in some bacteria. Biofilms can enhance bacterial survival and resistance to antibiotics, contributing to chronic infections.

  4. Interaction with Host Cells: The Kdp system may be involved in the interaction of E. coli with host cells. For example, potassium transport could affect the secretion of virulence factors or the adhesion of bacteria to host cells.

Research Findings

  • Flagella Expression: Magnesium and manganese divalent cations influence flagella expression in EPEC . Magnesium ions appear to be the most important divalent cations in activating flagella expression .

  • Host Signals: Host signals, such as sodium deoxycholate, pH levels, and carbon dioxide atmosphere, can activate flagella expression in EPEC .

  • Epithelial Cell Interaction: Host epithelial cells activate flagella expression in EPEC, with flagella production increasing in a time- and bacterial-concentration-dependent manner .

  • Adrenergic Molecules: Catecholamines like epinephrine and norepinephrine influence flagella expression in EPEC .

  • Genome Sequencing: The complete genome sequence of EPEC strain E2348/69 has been determined, providing a genomic context for understanding its virulence . The genome analysis revealed the entire gene repertoire related to E2348/69 virulence .

Tables and Figures Relating to the Study of E. coli O127:H6 and its Components

Table 1: Effect of Divalent Cationic Salts on Bacterial Motility

SaltConcentrationEffect on Motility
MgCl25 mMIncreased
MnCl25 mMIncreased
CaCl25 mMIncreased in DMEM
Magnesium sulfate5 mMIncreased

Figure 1: Effect of Magnesium and Manganese Divalent Cations on fliC Expression in EPEC

(A) Magnesium and (B) manganese chloride were added at 5–100 mM to LB or DMEM to measure fliC expression in E2348/69(pFAV36) (black bars) and E2348/69(pRS551) (white bars). (C) Effect of the addition of 5 mM EDTA to LB or DMEM on fliC expression. These data are the mean of at least three experiments performed in triplicate. * p < 0.05; *** p < 0.001. *

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
kdpC; E2348C_0585; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
kdpC
Target Protein Sequence
MRGLRPALSTFLFLLLITGGVYPLLTTALGQWWFPWQANGSLIREGDTVRGSALIGQNFT GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAELRAANPDASTNVPVEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE LNLALDKLDE
Uniprot No.

Target Background

Function
This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by forming a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the KdpFABC complex and what role does KdpC play in it?

The KdpFABC complex is an ATP-driven high-affinity potassium uptake system found in Bacteria and Archaea. It represents a fascinating chimera of two distinct classes of transporters: ion pumps and ion channels. The complex consists of four subunits - KdpF, KdpA, KdpB, and KdpC - each with specific functions in the potassium transport mechanism. The KdpA subunit facilitates K+ transport and resembles a potassium channel in structure, while the KdpB subunit hydrolyzes ATP and is classified as a type IA P-type ATPase .

The KdpC subunit functions as a catalytic chaperone in the nucleotide-binding mechanism, a role that is unique and found neither in typical P-type ATPases nor in ion channels. This subunit contains a conserved glutamine residue that is critical for high-affinity nucleotide binding to the KdpFABC complex. The interaction between KdpC and KdpB is ATP-dependent and occurs around the ATP-binding pocket, resulting in the formation of a transient KdpB/KdpC/ATP ternary complex that increases ATP-binding affinity .

How does the KdpC subunit contribute to ATP binding in the KdpFABC complex?

The KdpC subunit employs a nucleotide-binding mechanism that shares parallels with ABC transporters rather than with typical P-type ATPases. In ABC transporters, ATP is coordinated by the LSGGQ signature motif through double hydrogen bonds at a conserved glutamine residue. Interestingly, this conserved glutamine residue is also present in KdpC. Experimental evidence has demonstrated that high-affinity nucleotide binding to the KdpFABC complex is dependent on the presence of this specific glutamine residue in KdpC .

The binding mechanism is also influenced by the accessibility, presence, or absence of hydroxyl groups at the ribose moiety of the nucleotide. Both ATP binding to KdpC and ATP hydrolysis activity of the entire KdpFABC complex show sensitivity to these structural features of the nucleotide. Furthermore, KdpC interacts directly with the nucleotide-binding loop of KdpB in an ATP-dependent manner. This interaction occurs specifically around the ATP-binding pocket and results in the formation of a transient ternary complex consisting of KdpB, KdpC, and ATP, which significantly enhances the ATP-binding affinity of the system .

What experimental approaches are commonly used to study KdpC function?

Researchers employ several experimental techniques to investigate KdpC function within the KdpFABC complex. One fundamental approach involves reconstituting the Kdp-ATPase in liposomes that are then adsorbed to planar lipid membranes. This technique allows for the measurement of charge transport and the investigation of electrogenic events during the transport cycle. Such experimental setups are particularly valuable when studying the effects of mutations on transport function .

For investigating nucleotide binding, researchers often employ mutations of the conserved glutamine residue in KdpC to assess its role in ATP binding affinity. Additionally, experiments using ATP analogs with modifications to the ribose moiety help determine the specificity of the ATP binding site and the influence of these structural elements on both ATP binding to KdpC and the ATP hydrolysis activity of the entire complex .

To study the interaction between KdpC and KdpB subunits, techniques such as co-immunoprecipitation or crosslinking experiments can be used to capture the transient ternary complex formed by KdpB, KdpC, and ATP. These approaches allow researchers to understand the dynamics of subunit interactions during different stages of the transport cycle. When designing such experiments, it is essential to maintain conditions that prevent bias, carefully identify variables of interest, and ensure proper controls are in place 3.

How does the nucleotide-binding mechanism of KdpC differ from other P-type ATPases and what are the implications for experimental design?

The nucleotide-binding mechanism of KdpC represents a unique hybrid that distinguishes the KdpFABC complex from typical P-type ATPases. While the KdpB subunit classifies the complex as a type IA P-type ATPase based on its ATP-hydrolyzing properties, the nucleotide-binding mechanism involving KdpC more closely resembles that of ABC transporters. Specifically, in ABC transporters, the ATP nucleotide is coordinated by the LSGGQ signature motif via double hydrogen bonds at a conserved glutamine residue, which is paralleled in KdpC .

This hybrid nature has significant implications for experimental design. Researchers must account for both P-type ATPase and ABC transporter-like characteristics when designing studies. When investigating ATP binding kinetics, experimental protocols designed for P-type ATPases alone may yield incomplete results. Instead, approaches should incorporate methods that can detect the formation of the transient KdpB/KdpC/ATP ternary complex, which is critical for understanding the complete mechanism of ATP utilization by the complex .

Additionally, experiments should be designed to examine the sensitivity of both ATP binding to KdpC and ATP hydrolysis activity of KdpFABC to the accessibility, presence, or absence of hydroxyl groups at the ribose moiety of the nucleotide. This requires careful selection of ATP analogs with specific modifications to probe structure-function relationships. The unique nucleotide-binding mechanism also suggests that investigators should consider potential allosteric effects between subunits when analyzing experimental data, rather than treating each subunit as an independent functional unit .

What methodological approaches are effective for studying the transient KdpB/KdpC/ATP ternary complex formation?

Investigating the transient KdpB/KdpC/ATP ternary complex formation requires specialized methodological approaches due to its dynamic nature. Time-resolved techniques are particularly valuable for capturing these transient interactions. Rapid kinetic methods such as stopped-flow spectroscopy or quenched-flow approaches can be used to detect conformational changes or binding events on millisecond timescales.

Fluorescence resonance energy transfer (FRET) represents another powerful approach, where specific sites on KdpB and KdpC can be labeled with fluorophores to monitor their proximity during ATP binding and hydrolysis. This technique allows researchers to observe real-time changes in subunit interactions under various conditions. Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy offers an alternative approach for mapping distance changes between specific residues during the catalytic cycle.

Cross-linking studies using zero-length or short-distance cross-linkers can capture the transient complex at specific stages. By engineering cysteine residues at predicted interaction sites and applying cross-linking reagents at different stages of the ATP hydrolysis cycle, researchers can effectively "freeze" and then analyze the composition of the ternary complex. When designing such experiments, it is essential to ensure that the introduction of labels or mutations for cross-linking does not significantly alter the functional properties of the complex .

How can researchers distinguish between electrogenicity caused by KdpA versus KdpC in the transport mechanism?

Distinguishing between the electrogenic events associated with different subunits of the KdpFABC complex requires careful experimental design. Based on studies of charge transport using planar lipid membranes with adsorbed liposomes containing reconstituted Kdp-ATPase, researchers have identified distinct electrogenic steps in the transport cycle .

One effective approach involves using a mutant Kdp with altered K+ affinity (e.g., 6 mM instead of the wild-type's 2 μM) to study reactions under precisely controlled K+ concentrations. This strategy allows researchers to isolate and characterize K+-independent electrogenic events. When ATP is rapidly released from caged ATP in the absence of K+, a transient current is observed, indicating a K+-independent electrogenic step. In contrast, in the presence of K+, a stationary current is detected, representing the complete transport cycle .

Based on these observations and structural similarities to Na+/K+-ATPase, a kinetic model has been proposed where the first, K+-independent step is electrogenic and corresponds to the outward transport of a negative charge. This step is likely associated with conformational changes in the protein rather than direct K+ movement. The second step, which involves K+ translocation, is also probably electrogenic and corresponds to the transport of positive charge to the intracellular side .

To experimentally distinguish these events, researchers can implement voltage-clamp techniques while systematically varying K+ concentrations and ATP availability. Additionally, site-directed mutagenesis targeting specific residues in either KdpA or KdpC can help determine which subunit is responsible for particular electrogenic events by selectively disrupting specific aspects of the transport mechanism .

What approaches can be used to analyze conflicting data regarding KdpC's role in the KdpFABC complex?

When faced with conflicting data regarding KdpC's role in the KdpFABC complex, researchers should implement a systematic approach to data analysis and experimental design. First, a comprehensive meta-analysis of existing literature can help identify patterns in experimental conditions that might explain discrepancies. Variations in lipid composition of reconstitution membranes, protein purification methods, and buffer conditions can significantly impact the observed properties of membrane proteins like KdpC.

A multi-technique verification approach is also valuable - combining structural studies (X-ray crystallography, cryo-EM), functional assays (ATPase activity measurements, transport assays), and interaction studies (co-immunoprecipitation, FRET) provides complementary data that can resolve apparent contradictions. When discrepancies persist, computational modeling can be employed to test whether different proposed mechanisms can be reconciled within a broader theoretical framework that accounts for experimental variables .

How should researchers design experiments to study KdpC's role as a catalytic chaperone?

Designing experiments to study KdpC's role as a catalytic chaperone requires careful consideration of multiple factors. First, researchers should establish a baseline characterization of wild-type KdpC function within the intact KdpFABC complex. This includes measuring ATP binding affinity, ATP hydrolysis rates, and potassium transport activity under standardized conditions. Purification protocols should preserve the native conformation of the complex, which often requires specific detergent selections and buffer compositions.

A systematic mutational analysis approach is highly effective. Researchers should create a series of KdpC mutants, particularly targeting the conserved glutamine residue that participates in ATP coordination. Parallel mutations in regions that do not directly participate in ATP binding can serve as controls. Each mutant should be characterized for: (1) complex assembly capability, (2) ATP binding affinity, (3) ATP hydrolysis kinetics, and (4) potassium transport activity .

To specifically assess the chaperone function, researchers can design experiments that separate the binding and catalytic steps. For instance, pre-steady-state kinetic measurements using rapid-mixing techniques can isolate the initial ATP binding event from subsequent hydrolysis steps. Temperature-dependent studies can provide insights into the energetics of the chaperoning function, as chaperones typically lower activation energies for specific transitions .

Additionally, experiments should be designed to detect the formation of the transient KdpB/KdpC/ATP ternary complex. This could involve cross-linking approaches or fluorescence-based interaction assays that can capture transient molecular associations. When analyzing the resulting data, researchers should avoid bias toward expected outcomes and be prepared to revise hypotheses based on experimental evidence 3.

What data collection and analysis strategies are most appropriate for measuring ATP binding affinity changes in KdpC mutants?

When measuring ATP binding affinity changes in KdpC mutants, researchers should implement comprehensive data collection and analysis strategies to ensure reliable results. Multiple complementary techniques should be employed to measure ATP binding, including isothermal titration calorimetry (ITC), fluorescence-based assays using ATP analogs (such as TNP-ATP), and surface plasmon resonance (SPR).

For ITC experiments, careful baseline determination and control titrations are essential to account for dilution effects and non-specific binding. Data should be collected at multiple temperatures to determine thermodynamic parameters (ΔH, ΔS, and ΔG) that provide insights into the nature of the binding interaction. When using fluorescent ATP analogs, researchers should verify that the analog binds to the same site as ATP through competition assays with unmodified ATP .

Data analysis should incorporate appropriate binding models. While simple one-site binding models may be sufficient for initial analysis, more complex models accounting for potential cooperativity or multiple binding sites should be tested if the data show systematic deviations from simple models. Statistical approaches for model selection, such as F-tests or Akaike Information Criterion, can help determine the most appropriate binding model objectively.

How can researchers effectively isolate and purify recombinant E. coli O127:H6 KdpC for functional studies?

Effective isolation and purification of recombinant E. coli O127:H6 KdpC for functional studies requires optimized protocols that maintain protein integrity and function. Researchers should begin with molecular cloning of the kdpC gene from E. coli O127:H6 into an appropriate expression vector. The choice of affinity tag (e.g., His-tag, GST) should be made with consideration of its potential impact on KdpC function; when possible, constructs with removable tags are preferable.

Expression conditions require careful optimization, as membrane-associated proteins like KdpC can form inclusion bodies when overexpressed. Lower induction temperatures (16-25°C) and reduced inducer concentrations often improve the yield of correctly folded protein. For membrane-associated KdpC, expression in specialized E. coli strains designed for membrane protein production may be beneficial.

Cell lysis should be performed under gentle conditions using enzymatic methods (lysozyme) combined with mild detergents that can solubilize membrane-associated proteins without denaturing them. The choice of detergent is critical - initial screening of multiple detergents (DDM, CHAPS, digitonin) at various concentrations is advisable to identify conditions that maintain KdpC in a functional state.

For purification, a multi-step approach is recommended: initial capture using affinity chromatography based on the selected tag, followed by ion exchange chromatography and size exclusion chromatography to achieve high purity. Throughout the purification process, buffers should contain appropriate concentrations of potassium to maintain native conformation, and samples should be tested at each stage for ATP binding activity to ensure functionality is preserved.

Finally, researchers should verify the purity and integrity of the purified KdpC using techniques such as SDS-PAGE, western blotting, and mass spectrometry. Functional validation through ATP binding assays should be performed before proceeding with detailed mechanistic studies .

How should researchers design experiments to investigate the relationship between KdpC and charge transport in the KdpFABC complex?

Investigating the relationship between KdpC and charge transport in the KdpFABC complex requires sophisticated experimental designs that can detect and characterize electrogenic events. Researchers should establish experimental systems that allow for precise control of ionic conditions while measuring electrical currents associated with transport. One effective approach involves reconstituting purified KdpFABC complexes into liposomes, which can then be adsorbed to planar lipid membranes for electrophysiological measurements .

To specifically study KdpC's contribution to charge transport, comparative experiments using wild-type complexes and complexes with modified KdpC (through mutation of key residues or partial removal of functional domains) are essential. When K+ contamination is a concern, researchers can employ a strategy similar to published studies that used a Kdp mutant with reduced K+ affinity (6 mM instead of 2 μM for wild-type) to control for background K+ levels .

The experimental protocol should include methods for rapid ATP release, such as photolysis of caged ATP, to synchronize the initiation of transport cycles. This allows for the detection of transient currents that might be associated with specific steps in the transport mechanism. Measurements should be performed under varying conditions, including the presence and absence of K+, different membrane potentials, and various ATP concentrations .

What are the key considerations when designing mutagenesis studies of the conserved glutamine residue in KdpC?

Designing mutagenesis studies of the conserved glutamine residue in KdpC requires careful consideration of multiple factors to ensure meaningful results. First, researchers should conduct a thorough sequence alignment analysis across different bacterial species to confirm the evolutionary conservation of this glutamine residue and identify any natural variants that might provide insights into functional flexibility.

When selecting mutations, a rational approach should include: (1) conservative substitutions that maintain similar chemical properties (e.g., glutamine to asparagine) to test the importance of side chain length; (2) non-conservative substitutions (e.g., glutamine to alanine) to assess the essential nature of the amide group; and (3) charge-altering substitutions (e.g., glutamine to glutamic acid) to probe the role of electrostatic interactions in ATP binding .

How can researchers effectively compare data from different experimental models studying KdpC function?

Effectively comparing data from different experimental models studying KdpC function requires a systematic approach to address variability in experimental conditions and model systems. Researchers should first establish standardized reference conditions and measurements that can serve as calibration points across different experimental setups. For instance, wild-type KdpC activity measurements under defined conditions can provide a baseline for normalization.

When comparing in vitro reconstituted systems versus in vivo experiments, researchers should account for differences in membrane composition, protein concentrations, and the presence of additional cellular factors that might influence KdpC function. Quantitative measures such as relative activity (comparing mutant to wild-type in the same system) often provide more reliable cross-system comparisons than absolute values.

Meta-analysis techniques can be valuable when synthesizing data from multiple studies. This involves standardizing effect sizes and employing statistical methods that account for both within-study and between-study variations. Researchers should explicitly document all relevant experimental parameters, including protein purification methods, lipid compositions for reconstitution, buffer conditions, and analytical techniques used .

For studies using different species or strains of E. coli, sequence alignments should inform the interpretation of functional data. Conserved features across species likely represent core functional elements, while variable regions might reflect adaptation to specific ecological niches. When discrepancies arise between different experimental systems, targeted experiments can be designed to test specific hypotheses about the source of these differences, rather than simply discounting conflicting results .

What statistical approaches are most appropriate for analyzing ATP binding and hydrolysis data in KdpC studies?

When analyzing ATP binding and hydrolysis data in KdpC studies, researchers should implement appropriate statistical approaches to ensure reliable interpretations. For binding studies that generate saturation curves, nonlinear regression analysis using appropriate binding models (one-site, two-site, or cooperative binding) should be employed. Model selection should be based on statistical criteria such as the F-test or Akaike Information Criterion rather than visual assessment alone.

For kinetic data on ATP hydrolysis, Michaelis-Menten kinetic analysis can provide valuable parameters (Km, Vmax) that characterize the enzymatic properties of the complex. When comparing these parameters between wild-type and mutant variants, statistical tests such as Student's t-test (for comparing two conditions) or ANOVA (for multiple conditions) with appropriate post-hoc tests should be applied to determine statistical significance.

Time-series data, such as those generated in pre-steady-state kinetic experiments, often require more sophisticated analysis. Global fitting approaches that simultaneously analyze multiple datasets can provide more robust parameter estimates than individual curve fitting. For complex kinetic models with multiple steps, researchers should consider using numerical integration methods rather than analytical solutions, particularly when experimental conditions do not satisfy simplifying assumptions.

When integrating data from multiple experimental approaches, Bayesian statistical methods offer advantages by allowing the incorporation of prior knowledge and systematic handling of different sources of uncertainty. Regardless of the specific statistical approach, researchers should report not only best-fit parameters but also confidence intervals or standard errors to communicate the precision of their estimates 3.

How should researchers interpret data suggesting differences between KdpC function in in vitro reconstituted systems versus in vivo systems?

When interpreting data that suggests differences between KdpC function in in vitro reconstituted systems versus in vivo systems, researchers should consider multiple factors that might contribute to these discrepancies. First, the lipid environment differs significantly between artificial membranes used in reconstitution and bacterial membranes. Native membranes contain diverse lipid species and membrane proteins that might influence KdpC function through specific interactions or by affecting the physical properties of the membrane.

Researchers should systematically investigate how specific components of the in vivo environment might influence KdpC function. This could involve reconstitution experiments with increasingly complex lipid mixtures that better mimic the native membrane, or the addition of specific cellular factors suspected to interact with KdpC. Comparative studies using membrane extracts rather than defined lipid compositions can also provide insights into environmental factors affecting function.

Cellular regulation mechanisms present in vivo but absent in reconstituted systems can account for functional differences. These include post-translational modifications, interacting regulatory proteins, or metabolic feedback mechanisms. Researchers should examine whether KdpC undergoes any modifications in vivo that might be absent in recombinant systems, such as phosphorylation or other covalent changes.

When discrepancies persist despite controlled comparisons, researchers should consider whether the reconstituted system might represent a specific functional state of KdpC that exists transiently in vivo. Complementary approaches, such as studying KdpC function in spheroplasts or using genetic approaches to modify KdpC in its native context, can help bridge the gap between in vitro and in vivo observations .

What approaches can researchers use to develop comprehensive models of KdpC function that integrate diverse experimental data?

Developing comprehensive models of KdpC function that integrate diverse experimental data requires sophisticated approaches that can accommodate different data types and experimental conditions. Researchers should begin by categorizing available data according to the aspect of KdpC function they probe: structural information, binding kinetics, transport activity, and interactions with other subunits. This categorization helps identify gaps in current understanding and informs additional experiments needed.

Hierarchical modeling approaches are particularly valuable, where fundamental mechanisms established with high confidence form the core of the model, with additional layers incorporating more speculative or context-dependent aspects of function. For KdpC, the ATP binding mechanism involving the conserved glutamine residue could serve as a core element, with the relationship to electrogenic events representing a higher layer of the model .

Mathematical modeling using systems of differential equations can capture the dynamic behavior of the KdpFABC complex. Initial models should focus on established mechanisms, such as the formation of the KdpB/KdpC/ATP ternary complex, with additional complexity added as warranted by experimental data. Model parameters should be constrained using quantitative data from multiple experimental approaches, with sensitivity analysis used to identify parameters that strongly influence model predictions .

Computational approaches, including molecular dynamics simulations, can bridge gaps between structural and functional data by predicting conformational changes that occur during the transport cycle. These predictions can then be tested experimentally, creating an iterative cycle of model refinement. Throughout this process, researchers should explicitly state the assumptions underlying their models and identify testable predictions that can guide further experimental work .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.