Recombinant Escherichia coli O127:H6 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; E2348C_2402; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
arnE
Target Protein Sequence
MIWLTLVFASLLSVAGQLCQKQATCFATVNKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSLRHWCGVAFIIGGIVILGSTV
Uniprot No.

Target Background

Function
This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasm to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ArnE and what is its biological function in Escherichia coli?

ArnE functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex, which translocates Ara4N-modified lipid carriers across the bacterial inner membrane. This protein is part of the lipopolysaccharide (LPS) modification pathway that reduces the negative charge of bacterial outer membranes through the addition of positively charged Ara4N residues . The ArnE protein in E. coli O127:H6 is a membrane protein with approximately 111-115 amino acids, depending on the specific strain . It works in conjunction with ArnF to form a complete flippase complex critical for LPS modification and subsequent bacterial survival in hostile environments.

How does the structure of ArnE relate to its function in membrane transport?

The ArnE protein has been computationally modeled as a transmembrane protein with characteristic hydrophobic domains that anchor it within the bacterial inner membrane . Structural analysis using tools like AlphaFold has provided models with pLDDT (predicted local distance difference test) scores averaging around 87, indicating a confident structural prediction . The protein contains multiple transmembrane helices that form a channel or pore-like structure, which is consistent with its role in facilitating the flipping of lipid-linked substrates across the membrane. The amino acid sequence of ArnE typically contains hydrophobic stretches interspersed with charged residues that likely contribute to substrate recognition and translocation mechanisms .

What expression systems are recommended for recombinant ArnE production?

For laboratory-scale expression of recombinant ArnE, Escherichia coli BL21(DE3) has proven effective as demonstrated in multiple studies . The expression procedure typically involves:

  • Transformation of a suitable plasmid (such as pcDNA3.1 derivatives) containing the arnE gene into E. coli BL21(DE3)

  • Selection of transformants using appropriate antibiotics

  • Induction of protein expression using IPTG (isopropyl β-D-1-thiogalactopyranoside)

  • Verification of expression through methods such as SDS-PAGE and western blotting

For improved yields, expression conditions should be optimized regarding:

  • Temperature (often lowered to 18-25°C during induction)

  • IPTG concentration (typically 0.1-1.0 mM)

  • Duration of induction (4-24 hours)

  • Media composition (enriched media such as Terrific Broth may improve yields)

Note that the use of low IPTG concentrations (<0.1 mM) can help reduce potential toxicity effects while maintaining acceptable protein yields .

What methodological approaches are most effective for studying ArnE-mediated flippase activity in vitro?

Studying the flippase activity of membrane proteins like ArnE requires specialized techniques. Based on successful approaches with related flippases, the following methods are recommended:

a) Reconstitution in Liposomes:

  • Extract E. coli membrane lipids or use synthetic phospholipid mixtures

  • Purify recombinant ArnE (typically His-tagged) via Ni-NTA chromatography

  • Reconstitute purified protein into liposomes using detergent removal methods

  • Prepare radioactively or fluorescently labeled substrate analogs

b) Flippase Activity Assay:

A modified version of the assay used for Wzk flippase can be adapted for ArnE :

  • Incorporate purified ArnE into proteoliposomes

  • Load fluorescently labeled or radioactive Ara4N-phospholipid analogs into the inner leaflet

  • Monitor translocation to the outer leaflet over time

  • Use stopped-flow fluorescence spectroscopy or biochemical extraction methods to quantify translocation

c) Complementation Assays:

As demonstrated with Wzk, genetic complementation assays can assess flippase function:

  • Generate an E. coli strain with a deletable MurJ (essential flippase)

  • Express recombinant ArnE under an inducible promoter

  • Delete the chromosomal murJ gene

  • Assess viability as an indicator of functional complementation

These assays should include appropriate controls, including ATPase-deficient variants (e.g., Walker A/B motif mutations) to confirm specificity .

What are the challenges in purifying functional ArnE, and how can they be overcome?

Purification of membrane proteins like ArnE presents several challenges:

ChallengeSolution StrategyMethodological Details
Low expression levelsOptimize expression conditionsUse C41(DE3) or C43(DE3) E. coli strains designed for membrane protein expression; induce at lower temperatures (16-25°C); use lower IPTG concentrations (0.1-0.5 mM)
Protein aggregationImprove solubilizationScreen multiple detergents (DDM, LMNG, LDAO); add glycerol (10-20%) to buffers; include stabilizing agents like cholesteryl hemisuccinate
Maintaining native conformationOptimize purification conditionsUse mild detergents; limit exposure to high imidazole concentrations; perform purification at 4°C; include lipids in purification buffers
Protein instabilityStabilize with appropriate additivesInclude specific lipids; optimize pH and ionic strength; consider nanodiscs or SMALPs for alternative membrane mimetics
Low purityImplement multi-step purificationCombine IMAC (Ni-NTA) with size exclusion chromatography or ion exchange chromatography

The purification protocol should be validated using SDS-PAGE analysis and activity assays to ensure the isolated protein maintains its functional properties. Western blotting can confirm protein identity, while circular dichroism can assess secondary structure integrity .

How does ArnE compare functionally and structurally with other bacterial flippases such as ArnF and Wzk?

ArnE operates as part of a heterodimeric complex with ArnF to form a complete flippase unit for 4-amino-4-deoxy-L-arabinose translocation. Comparative analysis reveals important distinctions between these related flippases:

FlippaseSize (amino acids)MechanismSubstrate SpecificityStructural Features
ArnE111-115Proton gradient-dependent4-amino-4-deoxy-L-arabinose-phosphoundecaprenolMultiple transmembrane helices; functions as heterodimer with ArnF
ArnF145Proton gradient-dependent4-amino-4-deoxy-L-arabinose-phosphoundecaprenolComplementary to ArnE; required for complete flippase function
Wzk~400-500ATP-dependentMultiple substrates including O-antigen precursors and lipid IIContains Walker A/B motifs; can functionally replace MurJ; shows relaxed substrate specificity
MurJ~360Proton gradient-dependentLipid II (peptidoglycan precursor)Essential in E. coli but can be complemented by Wzk

Research has demonstrated that Wzk shows remarkable substrate promiscuity, capable of flipping various lipid-linked substrates including lipid II and N-glycosylation precursors. This contrasts with the more specialized function of the ArnE/ArnF complex . The ability of Wzk to substitute for MurJ in E. coli suggests potential evolutionary relationships or structural similarities in the substrate-binding regions despite different energy-coupling mechanisms (ATP hydrolysis versus proton gradients) .

Notably, site-directed mutagenesis studies targeting the Walker A/B motifs of Wzk (S405A, D524A, E525A) abolished both flippase activity and ability to complement MurJ deficiency, confirming the importance of ATP hydrolysis for function . Similar structure-function studies could be applied to ArnE to elucidate its mechanism.

What role does ArnE play in bacterial antibiotic resistance mechanisms?

The 4-amino-4-deoxy-L-arabinose (Ara4N) modification system, which includes ArnE, contributes significantly to bacterial antibiotic resistance through several mechanisms:

  • Polymyxin Resistance: By facilitating the addition of positively charged Ara4N to lipid A, ArnE indirectly reduces the net negative charge of the bacterial outer membrane, decreasing the binding affinity of cationic antimicrobial peptides like polymyxins .

  • Cross-Resistance Effects: Studies have shown that Ara4N modification can provide cross-resistance to other cationic antimicrobials and certain antibiotics that target the cell envelope.

  • Regulation by Environmental Signals: The expression of arnE and other genes in the Ara4N modification pathway is regulated by two-component systems responsive to environmental signals, such as low Mg²⁺ (PhoPQ) or the presence of antimicrobial peptides .

  • Integration with Other Resistance Mechanisms: The ArnE-facilitated pathway works in concert with other LPS modification systems and efflux pumps to create a comprehensive resistance network in Gram-negative bacteria.

Research indicates that inactivation of the Ara4N modification pathway, including disruption of ArnE function, can resensitize resistant bacteria to polymyxins and other antimicrobials . This makes ArnE a potential target for inhibitor development to overcome antimicrobial resistance.

How can fractional factorial design be applied to optimize ArnE expression and purification?

Fractional factorial design offers a powerful statistical approach for efficiently optimizing ArnE expression and purification parameters while minimizing experimental runs . This methodology can be implemented as follows:

  • Identify Key Variables: For ArnE expression and purification, relevant factors might include:

    • IPTG concentration (0.1-1.0 mM)

    • Induction temperature (16-37°C)

    • Induction duration (4-24 hours)

    • Detergent type (DDM, LMNG, etc.)

    • Detergent concentration (0.5-2× CMC)

    • Buffer pH (6.0-8.0)

    • Salt concentration (100-500 mM)

    • Glycerol percentage (0-20%)

  • Design the Experiment: For 8 factors, a 2^(8-3) fractional factorial design would require only 32 experimental runs instead of 256 (2^8), reducing effort by a factor of 8 .

  • Experimental Implementation:

    • Execute the designed experiments systematically

    • Measure response variables (protein yield, purity, activity)

    • Track any failed experiments without abandoning the design

  • Statistical Analysis:

    • Perform ANOVA to identify statistically significant factors

    • Calculate main effects for each variable

    • Identify interaction effects between variables

  • Optimization and Verification:

    • Determine optimal conditions based on statistical analysis

    • Run confirmatory experiments to verify predictions

This approach has been successfully applied to protein engineering challenges, as demonstrated in the optimization of nickel resin binding for AcrB mutations . The power of fractional factorial design lies in its ability to efficiently screen many variables while providing statistical confidence in the results.

What experimental approaches can be used to investigate ArnE-substrate interactions and specificity?

Understanding the substrate interactions and specificity of ArnE requires multiple complementary approaches:

a) Site-Directed Mutagenesis:

Target conserved residues in predicted transmembrane regions and substrate-binding pockets based on computational models . Key approaches include:

  • Alanine scanning of conserved residues

  • Charge reversal mutations for charged residues

  • Conservative substitutions to probe specific interactions

  • Creation of chimeric proteins with related flippases like ArnF

b) Binding Assays:

  • Microscale Thermophoresis (MST):

    • Label purified ArnE with fluorescent dyes

    • Measure binding to substrate analogs

    • Determine binding constants (Kd) for different substrates

  • Surface Plasmon Resonance (SPR):

    • Immobilize ArnE in supported lipid bilayers on sensor chips

    • Flow substrate analogs over the surface

    • Measure binding kinetics (kon, koff) and affinity

c) Computational Approaches:

  • Molecular docking of substrate analogs to ArnE structural models

  • Molecular dynamics simulations to identify stable binding conformations

  • Analysis of substrate binding paths and energy landscapes

d) Cross-linking Studies:

  • Synthesize photoactivatable substrate analogs

  • Perform UV-mediated cross-linking with purified ArnE

  • Identify cross-linked residues by mass spectrometry

e) Chimeric Protein Analysis:

Utilizing the demonstrated substrate flexibility of Wzk , chimeric constructs between ArnE and Wzk could reveal domains responsible for substrate specificity. Similar approaches have been successful with other flippases and could provide insights into the structural elements governing ArnE function.

How does metabolic burden affect recombinant ArnE expression, and what strategies can mitigate these effects?

Recombinant expression of membrane proteins like ArnE can impose significant metabolic burden on E. coli host cells, potentially limiting yields and protein quality . Understanding and addressing these challenges requires a multifaceted approach:

Metabolic Burden Mechanisms:

  • Competition for Ribosomes: Excessive recombinant mRNA can outcompete endogenous mRNA for ribosomes, impairing synthesis of host proteins essential for survival .

  • T7 RNA Polymerase Toxicity: High-level expression using the T7 system may lead to selection pressure for mutations that reduce T7 RNA polymerase activity .

  • Membrane Stress: Overexpression of membrane proteins can saturate membrane insertion machinery and disrupt membrane integrity.

  • Undecaprenyl Phosphate (Und-P) Depletion: Expression of proteins involved in lipid-linked oligosaccharide pathways can deplete the limited Und-P pool needed for essential cell wall biosynthesis .

Mitigation Strategies:

ChallengeSolution StrategyImplementation Details
Excessive mRNA productionReduce transcription rateUse lower IPTG concentrations (<0.1 mM); employ weaker promoters; use tunable expression systems
T7 RNA polymerase toxicityImplement alternative expression systemsConsider arabinose-inducible (PBAD) or tetracycline-inducible systems; use strains with genomically integrated T7 RNA polymerase under tight control
Toxic effects during inductionDecouple growth from expressionImplement the BL21-AI/gp2 system where cell growth is separated from recombinant protein production using phage-derived inhibitor peptides
Membrane protein insertion stressCo-express folding helpersAdd molecular chaperones (GroEL/ES) or membrane protein insertion facilitators (YidC)
Und-P depletionBalance lipid carrier utilizationWhen expressing LPS-modifying proteins, consider co-expressing undecaprenyl pyrophosphate phosphatase to increase Und-P recycling

Research has shown that optimizing expression conditions to minimize metabolic burden is critical for obtaining functional membrane proteins like ArnE. Monitoring cell morphology and division patterns during expression can provide insights into stress levels and help guide optimization efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.