Recombinant Escherichia coli O127:H6 Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

YciB is typically expressed in E. coli BL21(DE3) or similar strains using IPTG-inducible promoters. Production protocols include:

  • Expression System: E. coli with N-terminal 10×His tag for affinity purification .

  • Purification: Immobilized metal-ion chromatography (IMAC) under denaturing or native conditions.

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C/-80°C. Repeated freeze-thaw cycles degrade activity .

Purity: >85–90% verified via SDS-PAGE .

Research Applications

YciB is utilized in:

  • Functional Studies: Investigating septation mechanisms in EPEC pathogenesis .

  • Antibody Production: Immunogen for generating polyclonal or monoclonal antibodies .

  • Structural Biology: Potential target for membrane protein crystallization (though no published structures exist yet) .

Key Challenges and Considerations

  • Stability: Requires strict adherence to storage protocols to prevent aggregation .

  • Functional Data Gap: While annotated as a septation protein, direct mechanistic evidence remains limited. Studies linking YciB to cell division in E. coli O127:H6 are pending .

Future Directions

  • Structural Resolution: Cryo-EM or X-ray crystallography to elucidate membrane interaction sites.

  • Genetic Knockout Studies: To validate YciB’s role in septation and virulence .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; E2348C_1381; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQSVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YciB and where is it located in E. coli?

YciB is a small polytopic integral membrane protein located in the inner membrane of Escherichia coli. It belongs to a group of proteins whose functions were previously unidentified or incompletely understood, despite representing approximately one-third of E. coli inner membrane proteins. YciB plays a crucial role in maintaining cell envelope integrity through its interactions with cell elongation and division complexes. Recent research has illuminated its significance in membrane homeostasis and proper lipoprotein processing .

What is the membrane topology of YciB?

The membrane topology of YciB has been clarified through experimental studies. The protein contains five transmembrane domains that span the inner membrane of E. coli. This topology is critical for understanding its functional interactions with other membrane and periplasmic proteins. The transmembrane arrangement provides structural context for how YciB might participate in protein complexes involved in cell envelope synthesis and division machinery .

What are the primary functions of YciB in E. coli?

YciB functions primarily in cell envelope synthesis and maintenance through its interactions with cell elongation and division complexes. It plays a synergistic role with DcrB (another inner membrane protein) in maintaining proper lipoprotein processing and localization. When YciB function is compromised, particularly in combination with DcrB deficiency, significant envelope stress responses are activated, including Cpx and Rcs signaling systems. These responses attempt to counteract the resulting defects in lipoprotein maturation and mislocalization .

How does YciB contribute to cell envelope integrity?

YciB contributes to cell envelope integrity by supporting proper lipoprotein maturation and localization. In cells lacking both YciB and DcrB, the abundant outer membrane lipoprotein Lpp mislocalizes to the inner membrane, where it forms abnormal and toxic linkages to peptidoglycan. This mislocalization stems from inefficient lipid modification during the first step of lipoprotein maturation. YciB appears to influence membrane properties in ways that facilitate optimal function of Lgt (phosphatidylglycerol:preprolipoprotein diacylglyceryl transferase), the enzyme catalyzing the initial step in lipoprotein maturation .

What methods are effective for studying YciB membrane topology?

For studying YciB membrane topology, researchers should employ a combination of computational prediction and experimental validation approaches. Computational tools like TMHMM or Phobius can initially predict transmembrane domains, followed by experimental validation using techniques such as:

  • Cysteine accessibility methods: Introducing cysteine residues at various positions and testing their accessibility to membrane-impermeant thiol-reactive reagents

  • Reporter fusion analysis: Creating fusion proteins with reporters like PhoA (alkaline phosphatase) or GFP at different positions to determine periplasmic vs. cytoplasmic localization

  • Protease protection assays: Using proteases that cannot cross membranes to identify exposed regions

These approaches have successfully identified the five transmembrane domains in YciB, providing crucial structural information for understanding its function .

How can protein-protein interactions involving YciB be detected?

Protein-protein interactions involving YciB can be detected through several complementary approaches:

  • Bacterial two-hybrid system: This has successfully identified YciB interactions with proteins involved in cell elongation and division. The technique involves creating fusion proteins with fragments of a reporter protein that regain function only when brought into proximity through interaction .

  • Co-immunoprecipitation: Using antibodies against YciB or epitope-tagged versions to pull down interaction partners, followed by mass spectrometry identification.

  • Fluorescence microscopy co-localization: Visualizing the spatial and temporal co-occurrence of fluorescently tagged YciB with other division proteins.

  • Cross-linking methods: Chemical cross-linking followed by identification of interaction partners can capture transient or weak interactions.

These methods have revealed that YciB interacts with various proteins involved in cell elongation and division complexes, supporting its role in cell envelope synthesis .

What growth conditions reveal the phenotypes of yciB mutants?

The phenotypes of yciB mutants become most evident under specific stress conditions:

ConditionSingle yciB MutantyciB dcrB Double MutantObservations
Low salt mediaViableLethalDouble mutant shows synthetic lethality in low osmolarity conditions
Low temperature (≤20°C)ViableLethalTemperature sensitivity even in presence of salt
Standard lab conditionsViableViable with suppressorsSuppressors include lpp deletion or increased lgt expression

The deletion mutant of yciB is particularly susceptible to low osmolarity environments. More dramatic phenotypes emerge in the yciB dcrB double mutant, which exhibits synthetic lethality under low salt conditions. These observations indicate that YciB's function becomes critical under envelope stress conditions, particularly when combined with dcrB deletion .

What experimental approaches can assess alterations in membrane properties in yciB mutants?

Alterations in membrane properties in yciB mutants can be assessed through:

  • Laurdan spectroscopy: This fluorescence-based technique measures generalized polarization (GP) as an indicator of lipid packing and membrane fluidity. Higher GP values indicate reduced membrane fluidity. Studies have shown increased GP in yciB dcrB cells compared to wild-type or single mutants, suggesting increased lipid ordering .

  • Membrane fluidity assays: Using fluorescent probes like DPH (1,6-diphenyl-1,3,5-hexatriene) that change their fluorescence properties based on membrane fluidity.

  • Lipid composition analysis: Mass spectrometry-based lipidomics to determine changes in phospholipid composition that might affect membrane properties.

  • Growth sensitivity to membrane-active compounds: Testing sensitivity to compounds like detergents, certain antibiotics, or membrane fluidizers like benzyl alcohol.

These approaches can provide insights into how YciB affects membrane homeostasis, potentially explaining the observed defects in lipoprotein maturation when YciB is absent .

How does YciB contribute to bacterial cell division?

YciB contributes to bacterial cell division through its interactions with the divisome, a multiprotein complex that assembles at the midcell position to facilitate septum formation. As an inner membrane protein, YciB appears to play a role in coordinating membrane dynamics with the progression of cell division. The proper localization and function of YciB ensures that membrane invagination during division proceeds correctly, in coordination with peptidoglycan synthesis and outer membrane constriction.

In E. coli, cell division involves the localization of at least 15 proteins at the division site, forming rings across the cell width. These proteins collectively constitute the division ring, which constricts during division and ultimately disappears when cells separate. YciB's interaction with these division proteins suggests it plays a role in this complex process, potentially helping to maintain membrane homeostasis during the dramatic membrane remodeling that occurs during division .

What is the relationship between YciB and other septum formation proteins?

YciB interacts with various proteins involved in cell elongation and cell division, as demonstrated by bacterial two-hybrid analysis. In the context of septum formation, these interactions suggest YciB may be part of:

  • The hierarchical assembly pathway of division proteins in E. coli, where proteins localize to the division site in a specific temporal sequence.

  • The spatial organization of protein-protein interactions that leads to the assembly of the divisome or septosome.

While E. coli follows a somewhat linear sequence in divisome assembly, other bacteria like B. subtilis exhibit a more concerted or cooperative mode where most division proteins are interdependent for septal localization. Understanding where YciB fits in this process helps illuminate its specific role in septum formation .

How can YciB localization be visualized during the cell cycle?

YciB localization can be visualized during the cell cycle using:

  • Fluorescent protein fusions: Creating a functional YciB-GFP (or other fluorescent protein) fusion that can be expressed from its native promoter or under inducible control.

  • Time-lapse fluorescence microscopy: Capturing images at regular intervals to track YciB localization throughout the cell cycle.

  • Co-visualization with other divisome markers: Using differently colored fluorescent proteins to simultaneously track YciB and other divisome components (like FtsZ).

  • Super-resolution microscopy techniques: Methods like PALM, STORM, or structured illumination microscopy can provide higher resolution images of YciB localization relative to other cellular structures.

When conducting these experiments, it's essential to:

  • Verify that the fluorescent fusion doesn't disrupt YciB function

  • Use appropriate growth conditions where YciB phenotypes are most evident

  • Employ cell membrane stains as references for membrane dynamics

  • Consider immuno-fluorescence approaches as an alternative to protein fusions

Such visualization studies can reveal whether YciB localizes to the division ring, its timing of arrival relative to other division proteins, and its dynamics during septal constriction .

What is the relationship between YciB and lipoprotein maturation?

YciB plays a critical role in facilitating efficient lipoprotein maturation, particularly at the first step of the process. Lipoprotein maturation begins with the Lgt (phosphatidylglycerol:preprolipoprotein diacylglyceryl transferase) enzyme catalyzing the transfer of a diacylglyceryl moiety to preprolipoproteins. In cells lacking YciB, especially when combined with dcrB deletion, this initial lipid modification step becomes inefficient.

The relationship appears to involve YciB's influence on membrane properties rather than direct regulation of Lgt enzyme levels. Evidence suggests that YciB contributes to optimal membrane fluidity or organization that supports proper Lgt function. Consistent with this, overexpression of Lgt can rescue the growth defects in yciB dcrB double mutants, compensating for the inefficient maturation through increased enzyme abundance .

How does the YciB-DcrB interaction affect lipoprotein localization?

The interaction or functional synergy between YciB and DcrB is crucial for proper lipoprotein localization:

  • In wild-type cells: YciB and DcrB work together to maintain proper membrane properties that support efficient lipoprotein maturation. This ensures that lipoproteins like Lpp are correctly processed and transported to the outer membrane.

  • In yciB dcrB double mutants: The abundant outer membrane lipoprotein Lpp mislocalizes to the inner membrane. This mislocalization occurs because inefficient lipid modification in the first step of lipoprotein maturation prevents proper trafficking to the outer membrane.

  • Consequences of mislocalization: When Lpp remains at the inner membrane, it forms abnormal and toxic linkages to peptidoglycan, disrupting cell envelope integrity and activating stress response pathways.

This demonstrates that the combined function of YciB and DcrB, likely through their effects on membrane homeostasis, is essential for maintaining the correct subcellular distribution of lipoproteins .

What mechanisms underlie the synthetic lethality of yciB dcrB double mutants?

The synthetic lethality of yciB dcrB double mutants involves several interconnected mechanisms:

  • Primary defect: Attenuation of the first step of lipoprotein maturation (Lgt-mediated transacylation) at the inner membrane.

  • Consequence: The major outer membrane lipoprotein Lpp mislocalizes to the inner membrane, where it forms abnormal and toxic linkages to peptidoglycan.

  • Stress responses: Both Cpx and Rcs signaling systems are upregulated in response to the envelope stress.

  • Membrane alterations: The double mutant displays increased lipid ordering (reduced membrane fluidity) as measured by Laurdan spectroscopy.

  • Suppression mechanisms: The synthetic lethality can be suppressed by:

    • Deletion of lpp (eliminating the toxic protein)

    • Deletion of the lpp-peptidoglycan linkage site (preventing toxic linkages)

    • Overexpression of Lgt (enhancing the inefficient maturation step)

    • Deletion of skp (which works through the σE-MicL-Lpp regulatory loop to downregulate Lpp synthesis)

These findings indicate that the synthetic lethality stems from a complex interplay between membrane homeostasis, lipoprotein processing, and cell wall integrity .

How might YciB be targeted for antimicrobial development?

YciB represents a promising target for antimicrobial development based on several properties:

  • Essential function under stress conditions: While not essential under standard laboratory conditions, YciB becomes critical under certain stress conditions, particularly when combined with other mutations like dcrB deletion. This conditional essentiality could be exploited by combination therapies.

  • Role in membrane homeostasis: Compounds that further disrupt membrane properties in yciB mutants might exhibit synergistic antimicrobial effects, exploiting the already compromised membrane homeostasis.

  • Lipoprotein processing connection: Targeting YciB could indirectly disrupt lipoprotein maturation, leading to envelope stress and potential cell death through the accumulation of toxic intermediates.

  • Synthetic lethality approaches: The synthetic lethality observed with yciB dcrB double mutants suggests that combining YciB inhibitors with compounds affecting related pathways could yield potent antimicrobial effects.

Research approaches should include:

  • High-throughput screening for compounds that specifically interact with or inhibit YciB

  • Testing potential compounds under stress conditions where YciB is most critical

  • Evaluating synergy with existing antibiotics targeting cell envelope biogenesis

  • Assessing effects on membrane fluidity and lipoprotein processing as functional readouts

The ability to manipulate this pathway could lead to novel antimicrobial strategies targeting Gram-negative bacterial membrane homeostasis .

What insights can YciB research provide about membrane biogenesis?

YciB research offers valuable insights into membrane biogenesis processes:

  • Membrane-protein coordination: YciB appears to coordinate membrane dynamics with cell division and elongation processes, helping to understand how membrane biogenesis is integrated with cell growth.

  • Lipid-protein interactions: The effects of YciB absence on membrane fluidity suggest important roles in maintaining lipid homeostasis, potentially through specific lipid-protein interactions or by influencing lipid distribution.

  • Membrane adaptation mechanisms: The phenotypic enhancement of yciB mutants under stress conditions (low salt, low temperature) provides a window into how bacteria maintain membrane functionality under changing environmental conditions.

  • Lipoprotein integration: The connection between YciB and lipoprotein processing illuminates how membrane proteins facilitate the correct localization of lipid-anchored proteins, a critical aspect of envelope biogenesis.

  • Membrane stress responses: The activation of Cpx and Rcs signaling in yciB mutants offers insights into how bacteria sense and respond to membrane perturbations.

These insights contribute to our fundamental understanding of bacterial membrane biogenesis and may inform strategies for targeting these processes in biotechnological applications or antimicrobial development .

How does YciB function compare across different bacterial species?

Comparative analysis of YciB function across bacterial species reveals important evolutionary and functional insights:

Bacterial SpeciesYciB Homolog PresenceConservation LevelFunctional Significance
E. coli and related EnterobacteriaceaePresentHighMembrane homeostasis, cell division
Other Gram-negative bacteriaPresent with varying similarityModerateLikely similar roles with species-specific adaptations
Gram-positive bacteriaLimited homologsLowDifferent cell envelope architecture requires alternative mechanisms

Key comparative research considerations:

  • Sequence conservation analysis: Identifying highly conserved domains may highlight functionally critical regions of the protein.

  • Cross-species complementation: Testing whether YciB from different species can complement E. coli yciB mutants provides functional insights.

  • Species-specific interacting partners: Two-hybrid or pull-down studies across species may reveal conserved and divergent protein-protein interaction networks.

  • Phenotypic analysis in diverse bacteria: Creating yciB mutants in different bacterial species and characterizing their phenotypes under various conditions.

  • Correlation with membrane composition: Relating YciB function to species-specific differences in membrane lipid composition and fluidity.

These comparative approaches provide evolutionary context for YciB function and may reveal how this protein has adapted to different bacterial physiologies and environmental niches .

What challenges might arise when working with recombinant YciB proteins?

Working with recombinant YciB proteins presents several challenges that researchers should anticipate:

  • Expression difficulties:

    • As a membrane protein with five transmembrane domains, YciB can be toxic when overexpressed

    • Protein may aggregate or misfold in heterologous expression systems

    • Expression level may be too low for detection or purification

  • Solubilization issues:

    • Requires careful optimization of detergents to maintain native structure

    • Different detergents may affect protein stability and functionality differently

    • Native lipid environment may be crucial for proper folding and function

  • Purification complications:

    • Multiple transmembrane domains can lead to poor binding to purification resins

    • Tendency to form aggregates during concentration steps

    • Potential co-purification with endogenous bacterial lipids or interacting proteins

  • Functional assessment:

    • In vitro assays may not recapitulate the native membrane environment

    • Difficulties in reconstituting proper orientation in liposomes

    • Complex functional readouts that depend on membrane properties

Recommended strategies:

  • Use expression systems designed for membrane proteins (e.g., C41/C43 E. coli strains)

  • Consider fusion tags that enhance solubility or membrane targeting

  • Employ mild detergents and optimize purification conditions extensively

  • Include appropriate controls to verify proper folding and orientation

  • Consider in vivo functional complementation assays as validation

How can phenotypic inconsistencies in yciB mutant studies be resolved?

Phenotypic inconsistencies in yciB mutant studies can arise from several factors that need systematic resolution:

  • Growth condition standardization:

    • Carefully control medium composition, especially salt concentration

    • Standardize growth temperature, as yciB phenotypes are enhanced at lower temperatures

    • Define growth phase for analysis, as envelope properties change during growth

  • Genetic background considerations:

    • Ensure clean genetic manipulation without polar effects on neighboring genes

    • Verify the absence of spontaneous suppressor mutations (sequence verification)

    • Consider strain-specific differences in envelope composition

  • Experimental design refinements:

    • Use complementation tests to confirm phenotypes are due to yciB deletion

    • Create multiple independent mutants to rule out second-site mutations

    • Include appropriate controls (wild-type, single mutants) in all experiments

  • Analysis method standardization:

    • Standardize cell preparation methods for envelope analysis

    • Define clear metrics for phenotype quantification

    • Use multiple methods to assess the same phenotype (e.g., different stress sensitivity assays)

  • Systematic investigation of interacting factors:

    • Test for genetic interactions with related genes (e.g., dcrB)

    • Evaluate the effect of varying levels of Lpp expression

    • Assess the impact of activating or suppressing stress response pathways

By systematically addressing these factors, researchers can resolve inconsistencies and establish reliable phenotypic characterizations of yciB mutants .

What controls are essential for YciB localization studies?

For reliable YciB localization studies, several essential controls must be included:

  • Functional validation controls:

    • Complementation test: Confirm that the fluorescently tagged YciB rescues the yciB mutant phenotype

    • Expression level control: Verify that the tagged protein is expressed at near-native levels to avoid artifacts from overexpression

  • Specificity controls:

    • Non-specific binding control: Express the fluorescent tag alone to verify that observed localization patterns require YciB

    • Fixation artifact control: Compare live-cell imaging with fixed samples to identify potential fixation-induced artifacts

  • Co-localization reference controls:

    • Membrane marker: Include a general inner membrane marker to provide context for YciB localization

    • Division site marker: Co-visualize with established division proteins (e.g., FtsZ) to relate YciB localization to the division process

    • Negative spatial control: Include a protein known not to localize to the division site

  • Technical controls:

    • Photobleaching control: Monitor and correct for photobleaching during time-lapse imaging

    • Channel bleed-through control: For multi-color imaging, verify spectral separation

    • Z-stack acquisition: Collect images at multiple focal planes to ensure complete visualization of the cell

  • Temporal controls:

    • Cell cycle markers: Include methods to determine the cell cycle stage of individual cells

    • Synchronization validation: If using synchronized cultures, verify the degree of synchrony

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.