Recombinant Escherichia coli O127:H6 Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O127:H6 Probable Ubiquinone Biosynthesis Protein UbiB (ubiB)

The Recombinant Escherichia coli O127:H6 Probable Ubiquinone Biosynthesis Protein UbiB (ubiB) is a genetically engineered protein derived from the ubiB gene in Escherichia coli. This protein plays a crucial role in the biosynthesis of ubiquinone (Coenzyme Q), which is essential for the electron transport chain and oxidative phosphorylation in bacteria. The ubiB gene is part of an operon that includes ubiE and yigP, and its disruption affects CoQ biosynthesis by causing the accumulation of octaprenylphenol, a precursor in the CoQ biosynthetic pathway .

Role of UbiB in Ubiquinone Biosynthesis

UbiB is involved in the first monooxygenase step of CoQ biosynthesis. Mutations in the ubiB gene lead to the accumulation of 2-octaprenylphenol, indicating its essential role in converting this intermediate into further products in the CoQ biosynthetic pathway . The protein is also a member of a predicted protein kinase family, similar to the ABC1 gene in Saccharomyces cerevisiae, suggesting potential kinase activity that could regulate CoQ biosynthesis through phosphorylation .

Genetic and Biochemical Characteristics

  • Genetic Location: The ubiB gene is closely linked to ubiD in Escherichia coli, and mutations in these genes result in the accumulation of different intermediates in the CoQ biosynthetic pathway .

  • Operon Structure: ubiB is part of an operon with ubiE and yigP. The ubiE gene encodes a C-methyltransferase necessary for both CoQ and menaquinone synthesis .

  • Protein Kinase Activity: Although not definitively proven, UbiB's similarity to protein kinases suggests it might play a regulatory role in CoQ biosynthesis by phosphorylating key enzymes .

Research Findings and Implications

Recent studies have highlighted the importance of UbiB family proteins in mitochondrial function and CoQ distribution. In yeast, UbiB-like proteins (e.g., Cqd1 and Cqd2) influence CoQ distribution without affecting total cellular CoQ levels . The development of inhibitors for UbiB family proteins, such as COQ8, has provided tools for studying their roles in CoQ biosynthesis and potential therapeutic applications .

Table 1: Accumulation of Intermediates in ubiB Mutants

Mutant GeneAccumulated Intermediate
ubiB2-octaprenylphenol
ubiD3-octaprenyl-4-hydroxybenzoic acid

Table 2: Functions of UbiB Family Proteins

ProteinFunction
UbiBInvolved in CoQ biosynthesis
Cqd1/Cqd2Influence CoQ distribution in mitochondria
COQ8Essential for CoQ biosynthesis in humans

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ubiB; E2348C_4149; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
ubiB
Target Protein Sequence
MTPGEVRRLYFIIRTFLSYGLDELIPKMRITLPLRLWRYSLFWMPNRHKDKPLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGLPVEA WFDDFEIKPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIKADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLYIPEVYPDYCSEGM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEH PENPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEEFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELPELVYDSLRQGKYLQH SVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFLLVSRPEWGLMPGWLMAGGLIAWFV GWRKTR
Uniprot No.

Target Background

Function

This protein is likely a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.

Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.