Recombinant Escherichia coli O127:H6 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand that specific requirements may arise. Should you have a preference for a particular format, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on your purchasing method and location. For accurate delivery timeframes, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs as a default. If dry ice shipping is preferred, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for a period of up to one week.
Reconstitution
We recommend a brief centrifugation of the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to achieve a concentration range of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, serving as a reference point.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the liquid form exhibits a shelf life of 6 months at -20°C/-80°C. For the lyophilized form, the shelf life extends to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; E2348C_3097; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) is an enzyme that catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Lgt in bacterial physiology?

Lgt catalyzes the first step in the biogenesis of Gram-negative bacterial lipoproteins, which play crucial roles in bacterial growth and pathogenesis . The enzyme transfers a diacylglyceryl group from phosphatidylglycerol (PG) to the sulfhydryl group of the conserved cysteine residue in the lipobox motif of prolipoproteins . This lipidation is essential for proper localization and function of bacterial lipoproteins, which contribute to membrane integrity, nutrient acquisition, and virulence .

Research shows that even modest depletion of Lgt in uropathogenic E. coli leads to increased outer membrane permeability, sensitivity to serum killing, and enhanced susceptibility to antibiotics that are normally excluded by the Gram-negative outer membrane . Complete depletion of Lgt is lethal to bacteria, highlighting its essential role in bacterial viability .

What is the catalytic mechanism of Lgt?

Lgt catalyzes a diacylglyceryl transfer from phosphatidylglycerol to the cysteine residue of the prolipoprotein via a SN2-like concerted mechanism . QM/MM calculations reveal that this reaction proceeds with an activation energy of approximately 18.6 kcal/mol, which aligns well with experimental values .

The mechanism involves:

  • His103 acting as a catalytic base to abstract the proton from the cysteine residue of the prolipoprotein peptide

  • The deprotonated cysteine then undergoes nucleophilic attack on the C3 carbon of the C3-O ester in phosphatidylglycerol

  • This results in the formation of diacylglyceryl-prolipoprotein

The reaction generates negative charge due to the cleavage of the C3-O bond on the phosphate group, which is stabilized by electrostatic interaction with Arg143 .

How does Lgt inhibition affect bacterial cell structure and function?

Inhibition or depletion of Lgt causes multiple structural and functional defects in bacteria:

  • Increased outer membrane permeability: Even partial depletion of Lgt (by approximately 25%) leads to increased incorporation of membrane-impermeable dyes like SYTOX Green, indicating compromised outer membrane integrity .

  • Morphological changes: Lgt inhibition results in increased cell size and outer membrane blebbing, similar to what has been observed in Pal-deficient E. coli strains .

  • Enhanced antibiotic susceptibility: Bacterial cells with reduced Lgt activity show increased sensitivity to antibiotics that are normally excluded by the impermeable Gram-negative outer membrane .

  • Increased serum sensitivity: Partial depletion of Lgt makes normally serum-resistant E. coli CFT073 significantly more sensitive to complement-mediated killing .

  • Attenuation of virulence: Lgt depletion results in significant attenuation in mouse bacteremic infection models .

What structural elements of Lgt are critical for substrate recognition and catalysis?

Several key structural elements and amino acid residues in Lgt are essential for substrate recognition and catalytic activity:

  • The catalytic site: His103 serves as the catalytic base for deprotonating the cysteine residue of the prolipoprotein substrate . This residue is critical for the enzyme's function, as mutations dramatically affect enzyme activity.

  • Substrate binding pocket: The binding site for the prolipoprotein signal peptide is organized around the lipobox motif (GSTLLAGCSSN), with specific interactions that position the conserved cysteine for nucleophilic attack .

  • Phosphatidylglycerol binding: Arg143 and Asn146 participate in stabilizing the negative charge that develops during the reaction . Arg143 forms electrostatic interactions with the phosphate group of PG.

  • The transmembrane helices: These create a hydrophobic environment conducive to lipid substrate binding and orientation within the membrane.

Multiple sequence alignments of Lgt proteins from different bacterial species indicate that these catalytic residues are highly conserved, suggesting a common mechanism across bacterial taxa .

How can Lgt inhibitors be developed and characterized for antimicrobial research?

Development and characterization of Lgt inhibitors follows several methodological approaches:

  • Biochemical screening: Novel inhibitors can be identified using high-throughput screens measuring Lgt enzymatic activity in vitro . The first reported Lgt inhibitors, macrocyclic compounds G2823 and G2824, were discovered and validated using such approaches .

  • Validation of on-target activity: Multiple complementary methods should be employed to confirm that growth inhibition is due to specific Lgt inhibition rather than off-target effects:

    • Western blot analysis to detect accumulation of pro-Lpp (the substrate of Lgt)

    • Microscopy to observe characteristic morphological changes (increased cell size, OM blebbing)

    • CRISPRi technology to demonstrate sensitization to inhibitors through reduced target expression

  • Structure-based design: Computational approaches using the solved crystal structure of Lgt can guide rational design of inhibitors targeting the active site or substrate binding pockets .

  • Resistance studies: Attempts to raise on-target resistant mutants can provide insights into inhibitor binding sites and potential resistance mechanisms .

For example, research has demonstrated that macrocyclic compounds G2823 and G2824 inhibit both Lgt enzymatic function and bacterial growth with on-target specificity, as evidenced by the accumulation of pro-Lpp and sensitization of cells with reduced Lgt expression .

What methodological approaches are most effective for studying Lgt function in vivo?

Several complementary approaches have proven effective for studying Lgt function in vivo:

  • Genetic depletion systems: Placing the only copy of lgt under control of an inducible promoter (e.g., arabinose-inducible promoter) allows for controlled depletion of Lgt and examination of the resulting phenotypes . This approach revealed that even partial Lgt depletion leads to increased membrane permeability and antibiotic sensitivity .

  • CRISPRi technology: This approach allows for modulation of gene expression without complete deletion, enabling studies of essential genes like lgt . By using guide RNAs specific to lgt, researchers can decrease Lgt expression and study the resulting phenotypes or sensitivity to inhibitors .

  • Complementation studies: Expressing Lgt from different bacterial species in an Lgt-depleted strain can provide insights into functional conservation and species-specific differences . For example, Lgt from Pseudomonas aeruginosa and Acinetobacter baumannii can rescue viability in E. coli Lgt-depleted strains despite only ~50% sequence identity .

  • Western blot analyses: Detection of Lpp forms (pro-Lpp, diacylated Lpp, triacylated Lpp) can verify inhibition or deletion of specific enzymes involved in lipoprotein biosynthesis . This approach can track the accumulation of Lgt substrates when the enzyme is inhibited or depleted .

  • Infection models: Mouse bacteremic infection models have been used to demonstrate that Lgt depletion results in significant attenuation of virulence, highlighting the importance of Lgt in pathogenesis .

What are the optimal conditions for expressing and purifying recombinant Lgt?

While the search results don't provide specific protocols for Lgt purification, general principles for membrane protein expression and purification can be applied, with modifications based on the properties of Lgt:

  • Expression system: E. coli expression systems are commonly used for recombinant Lgt production, with selection of appropriate strains that can handle membrane protein expression .

  • Expression constructs: Recombinant Lgt is typically expressed with affinity tags to facilitate purification. The tag type should be determined during the production process to optimize yield and activity .

  • Storage conditions: Purified Lgt should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided .

  • Solubilization: As an integral membrane protein, Lgt requires careful selection of detergents for solubilization that maintain enzymatic activity.

  • Quality control: Recombinant Lgt should be assessed for purity using SDS-PAGE and for functional activity using enzymatic assays that measure diacylglyceryl transfer.

How can Lgt activity be reliably measured in vitro?

Several complementary approaches can be used to measure Lgt activity in vitro:

  • Biochemical assays: Direct measurement of diacylglyceryl transfer from phosphatidylglycerol to synthetic prolipoprotein peptide substrates can be performed using radiolabeled substrates or fluorescently labeled peptides .

  • Western blot analyses: The accumulation of pro-Lpp, the substrate of Lgt, can be detected by Western blot analyses using antibodies specific to Lpp . This approach has been successfully used to verify inhibition or deletion of specific enzymes involved in lipoprotein biosynthesis .

  • SDS fractionation: This technique can be used to separate peptidoglycan-associated proteins (PAP) and non-PAP fractions, allowing for the identification of different Lpp forms by Western blot analysis . The fastest migrating form represents the triacylated mature form of Lpp, while other forms correspond to different intermediates in the lipoprotein biosynthesis pathway .

  • Computational validation: QM/MM calculations can be used to model and validate the reaction mechanism and to predict the effects of mutations or inhibitors on Lgt activity . The estimated activation energy from such calculations (18.6 kcal/mol) has been shown to agree well with experimental values .

How does E. coli Lgt differ from Lgt in other bacterial species?

E. coli Lgt shares significant but not complete sequence identity with Lgt from other bacterial species, suggesting both functional conservation and potential species-specific adaptations:

  • Sequence homology: E. coli Lgt shares 51.6% sequence identity with Pseudomonas aeruginosa PA14 Lgt and 48.6% sequence identity with Acinetobacter baumannii ATCC 17978 Lgt .

  • Functional conservation: Despite these sequence differences, Lgt from P. aeruginosa and A. baumannii can rescue viability in E. coli Lgt-depleted strains, indicating functional conservation of the essential catalytic mechanism .

  • Structural elements: Key catalytic residues, including His103 and Arg143, are conserved across different bacterial species, further supporting a common catalytic mechanism .

  • Species-specific features: Differences in non-catalytic regions may reflect adaptations to specific membrane compositions or regulatory mechanisms in different bacterial species.

  • Inhibitor sensitivity: The conservation of key structural and functional elements suggests that Lgt inhibitors might have broad-spectrum activity against multiple bacterial species, as demonstrated by compounds that inhibit both E. coli and A. baumannii growth .

What is the potential of Lgt as a target for antimicrobial development?

Several lines of evidence support Lgt as a promising target for antimicrobial development:

  • Essential function: Lgt is essential for bacterial viability, making it a logical target for antibacterial drugs . Genetic depletion of Lgt is lethal in vitro for E. coli .

  • Broad conservation: Lgt is conserved across diverse bacterial species, suggesting the potential for broad-spectrum antibiotics targeting this enzyme .

  • Vulnerability to partial inhibition: Even modest depletion of Lgt (approximately 25%) is sufficient for bactericidal activity, and cells with reduced Lgt levels show increased sensitivity to serum killing and antibiotics . This suggests that even partial inhibition of Lgt could be therapeutically effective.

  • Proof-of-concept inhibitors: The first inhibitors of Lgt that inhibit both enzymatic activity in vitro and bacterial growth have been identified and characterized . These macrocyclic compounds (G2823 and G2824) are bactericidal against wild-type A. baumannii and E. coli strains .

  • Reduced resistance potential: Unlike inhibition of other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein (lpp) is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors . This suggests that resistance to Lgt inhibitors might be less likely to develop compared to inhibitors of downstream steps in lipoprotein biosynthesis.

  • Attenuation in infection models: Lgt depletion results in significant attenuation in a mouse E. coli bacteremic infection model, supporting the potential clinical relevance of Lgt inhibition .

What are the most promising approaches for future Lgt research?

Several promising directions for future Lgt research emerge from current findings:

  • Structure-based drug design: The elucidation of the catalytic mechanism of Lgt provides novel insights for structure-based design of broad-spectrum antimicrobial therapies targeting enzymes involved in post-translational modification of lipoproteins .

  • Combination therapies: Exploring the synergistic effects of Lgt inhibitors with existing antibiotics could lead to more effective treatment strategies, particularly against antibiotic-resistant bacteria .

  • Expanded understanding of substrate recognition: Further research into how Lgt recognizes diverse prolipoprotein substrates could provide insights into bacterial lipoprotein biosynthesis and potential additional targeting strategies .

  • In vivo efficacy studies: Evaluation of Lgt inhibitors in diverse infection models would help determine their therapeutic potential and pharmacological properties .

  • Resistance mechanisms: Although resistance to Lgt inhibitors appears challenging for bacteria to develop, systematic studies of potential resistance mechanisms would inform drug development strategies .

  • Structural biology: Further structural studies of Lgt in complex with substrates and inhibitors would enhance understanding of its function and facilitate rational drug design .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.