Recombinant Escherichia coli O127:H6 Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Functional Role and Substrate Specificity

GlpG cleaves substrates at hydrophilic regions near transmembrane domains. Key findings include:

  • In Vivo Activity: Cleaves model substrates (e.g., Bla-LY2-MBP) between Ser and Asp residues, dependent on conserved Ser/His catalytic dyad .

  • Substrate Recognition: Preferentially targets transmembrane helices with specific hydrophilicity patterns, facilitating lateral entry into the active site .

  • Physiological Role: Promotes persistence of extraintestinal pathogenic E. coli (ExPEC) in the gut by enhancing fatty acid β-oxidation and glycerol metabolism .

Applications in Research

Recombinant GlpG is critical for:

  • Mechanistic Studies: Elucidating RIP mechanisms in bacterial membranes .

  • Drug Discovery: Screening inhibitors targeting rhomboid proteases in pathogens .

  • Biochemical Assays: Optimizing protease activity using fluorogenic substrates or engineered model proteins .

Key Research Findings

  • Gut Colonization: ΔglpG mutants exhibit >120-fold reduced fitness in murine gut models, underscoring its role in ExPEC survival .

  • Enzyme Kinetics: In vitro assays confirm GlpG cleaves substrates at rates influenced by lipid bilayer composition .

  • Regulatory Link: Polar effects on glpR (a glycerol metabolism regulator) suggest GlpG indirectly modulates carbon source utilization .

Challenges and Future Directions

  • Substrate Identification: Natural substrates of GlpG remain poorly characterized .

  • Structural Dynamics: Further studies in native lipid environments are needed to resolve substrate-binding mechanisms .

  • Therapeutic Potential: Targeting GlpG could disrupt ExPEC colonization, offering a novel antibacterial strategy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
glpG; E2348C_3668; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function

Rhomboid-type serine protease that catalyzes intramembrane proteolysis.

Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural topology of Escherichia coli O127:H6 Rhomboid protease glpG?

Escherichia coli GlpG is a membrane-embedded serine protease that belongs to the rhomboid family of intramembrane proteases. Structural analysis confirms that glpG traverses the membrane six times with transmembrane domains connected by loop regions of varying lengths . The catalytic domain contains conserved serine and histidine residues essential for proteolytic activity, forming a catalytic dyad rather than the triad common in other serine proteases . The protein adopts a complex tertiary structure within the membrane that creates a hydrophilic cavity accessible to substrate proteins, allowing water molecules to enter for the hydrolytic reaction despite the hydrophobic membrane environment .

How does membrane environment affect glpG activity?

The membrane environment significantly impacts glpG activity through multiple mechanisms:

Membrane ParameterEffect on glpG ActivityResearch Finding
Hydrophobic thicknessOptimal between 24-26 ÅActivity decreases in thicker or thinner membranes
Lipid compositionModerate effectNo specific headgroup requirement, but composition affects membrane properties
Membrane thinningInduced by glpGThins E. coli-relevant lipid membranes by 1.1 Å per leaflet
Lipid dynamicsAffects substrate accessInfluences substrate diffusion and recognition

GlpG actively modifies its surrounding membrane environment, creating an optimal local thickness that facilitates both substrate recognition and catalytic activity . This membrane remodeling demonstrates how membrane proteins can shape their lipid environment to enhance functionality .

What purification methods yield highest activity for recombinant glpG?

Purifying active recombinant glpG requires carefully optimized protocols that maintain protein integrity while removing membrane lipids:

  • Expression system selection: E. coli BL21(DE3) with pET-based vectors containing an N-terminal His6-tag has proven most effective for glpG expression .

  • Membrane fraction isolation:

    • Culture cells to mid-log phase (OD600 = 0.6-0.8)

    • Induce with 0.5 mM IPTG at 20°C for 16-18 hours

    • Harvest cells and disrupt by sonication in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, and protease inhibitors

    • Ultracentrifuge at 100,000 × g to isolate membrane fractions

  • Solubilization optimization:

    • Test multiple detergents for optimal activity retention

    • n-Dodecyl-β-D-maltoside (DDM) at 1% w/v maintains highest activity

    • Solubilize for 1 hour at 4°C with gentle agitation

  • Affinity purification:

    • Bind to Ni-NTA resin

    • Wash with buffer containing 20 mM imidazole and 0.1% DDM

    • Elute with 250 mM imidazole

    • Further purify by size exclusion chromatography using Superdex 200

The purification yield is typically 2-3 mg of protein per liter of culture, with >95% purity as determined by SDS-PAGE .

How can researchers develop effective in vitro assays for glpG activity?

Developing robust in vitro assays for glpG activity requires careful consideration of substrate design, reaction conditions, and detection methods:

  • Model substrate construction:

    • Design chimeric proteins containing:

      • N-terminal periplasmically-localized domain (e.g., beta-lactamase)

      • Transmembrane segment derived from known substrates (e.g., LacY)

      • C-terminal cytosolic domain (e.g., maltose binding protein)

  • Reconstitution system optimization:

    • Incorporate purified glpG into proteoliposomes

    • Test various lipid compositions including E. coli membrane mimics

    • Control hydrophobic thickness between 24-26 Å for optimal activity

  • Reaction conditions:

    • Buffer: 50 mM HEPES pH 7.5, 150 mM NaCl

    • Temperature: 37°C

    • Time course: Sample at intervals from 0-24 hours

    • Detergent: 0.1% DDM or equivalent

  • Activity detection methods:

    • SDS-PAGE with western blotting to detect cleavage products

    • FRET-based peptide substrates for continuous monitoring

    • Mass spectrometry to identify precise cleavage sites

For quantitative analysis, researchers should establish standard curves using purified cleavage products and calculate initial velocities at various substrate concentrations to determine kinetic parameters (KM, Vmax) .

How can researchers identify physiological substrates of glpG in Escherichia coli?

Identifying physiological substrates of glpG requires multi-faceted approaches that combine genetic, biochemical, and proteomic techniques:

  • Genetic approaches:

    • Generate glpG knockout and overexpression strains

    • Conduct global transcriptomic and proteomic analyses to identify differentially regulated proteins

    • Compare membrane proteome profiles between wild-type and mutant strains

  • Substrate trapping:

    • Engineer catalytically inactive glpG mutants (S201A)

    • Add chemical crosslinkers to stabilize enzyme-substrate complexes

    • Isolate complexes via affinity purification

    • Identify trapped substrates by mass spectrometry

  • In vivo validation:

    • Construct fluorescent reporter fusions to candidate substrates

    • Monitor localization and processing in wild-type vs. ΔglpG strains

    • Quantify processing efficiency using western blot analysis

  • Consensus sequence analysis:

    • Align identified substrates to determine recognition motifs

    • Focus on transmembrane domain sequences and juxtamembrane regions

    • Validate using synthetic peptide libraries

Researchers should note that glpG recognizes specific features of transmembrane regions rather than strict consensus sequences, making substrate prediction challenging .

What approaches can detect conformational changes in glpG during catalysis?

Monitoring conformational changes in membrane-embedded proteases like glpG requires specialized biophysical techniques:

  • Site-directed spin labeling with EPR spectroscopy:

    • Introduce cysteine residues at strategic positions

    • Label with nitroxide spin probes

    • Measure distances between labeled sites

    • Monitor mobility changes during substrate binding and catalysis

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Expose purified glpG to D2O buffer

    • Analyze deuterium incorporation patterns

    • Identify regions with altered solvent accessibility during catalysis

    • Map dynamic regions onto structural models

  • Single-molecule FRET:

    • Label transmembrane helices with donor-acceptor fluorophore pairs

    • Monitor distance changes during substrate processing

    • Calculate energy transfer efficiency changes

    • Correlate with catalytic states

  • Molecular dynamics simulations:

    • Build atomic models of glpG in membrane environments

    • Simulate conformational changes during substrate binding

    • Predict water accessibility to the catalytic site

    • Validate computational models with experimental data

These approaches reveal that glpG undergoes subtle but significant conformational changes during catalysis, particularly in transmembrane helices TM5 and TM6, which modulate substrate access to the catalytic site .

How can researchers resolve contradictions in membrane thickness requirements for glpG activity?

Studies on membrane thickness requirements for glpG activity have yielded seemingly contradictory results that require careful analysis:

  • Identifying sources of experimental variation:

    • Lipid composition differences between studies

    • Substrate design variations

    • Detergent effects on purified enzyme

    • Temperature and buffer condition discrepancies

  • Standardized measurement approaches:

    • Use consistent membrane thickness measurement techniques

    • Employ multiple biophysical methods (X-ray scattering, neutron diffraction)

    • Establish controlled reconstitution systems with defined lipid compositions

  • Reconciling contradictory findings:

    • When studies report different optimal thicknesses, examine:

      • Local vs. global membrane effects

      • Protein concentration effects on membrane properties

      • Presence of membrane microdomains

      • Effects of curvature and lateral pressure

  • Data integration framework:

    • Plot activity vs. membrane thickness from multiple studies

    • Normalize data to account for methodological differences

    • Develop mathematical models incorporating multiple parameters

    • Test models with new experimental designs

Research shows that glpG actively thins E. coli-relevant lipid membranes by approximately 1.1 Å per leaflet, suggesting that the protein creates its optimal local environment regardless of bulk membrane properties . This membrane remodeling capacity explains why activity correlates more with the protein's ability to achieve optimal local thickness than with initial membrane conditions .

How should researchers address data contradictions when analyzing glpG substrate specificity?

Contradictory findings regarding glpG substrate specificity can be systematically addressed through:

  • Standardization of substrate constructs:

    • Create a reference set of model substrates

    • Ensure consistent transmembrane domain lengths

    • Standardize flanking domains

    • Control expression levels in vivo

  • Context-dependent specificity analysis:

    • Test identical substrates in different membrane compositions

    • Evaluate temperature dependence of specificity

    • Assess effects of membrane fluidity on recognition

    • Examine pH effects on substrate binding

  • Resolution of sequence vs. structure recognition:

    • Design transmembrane domains with conserved structural features but varied sequences

    • Create chimeric substrates with domains from different organisms

    • Mutate key residues to assess recognition determinants

    • Use computational structure prediction to identify common structural motifs

  • Integrated bioinformatic approach:

    • Compile substrate data from multiple studies

    • Use machine learning algorithms to identify recognition patterns

    • Develop predictive models incorporating both sequence and structural features

    • Validate predictions experimentally

Current evidence suggests that glpG recognizes structural features of transmembrane domains rather than specific sequences, explaining why sequence-based prediction methods often yield contradictory results . The proteolytic cleavage typically occurs between serine and aspartic acid residues in regions of high local hydrophilicity, which might be positioned in juxtamembrane rather than intramembrane locations .

How do advances in contradiction detection in retrieval augmented generation systems impact glpG research?

Recent developments in contradiction detection for retrieval augmented generation (RAG) systems have significant implications for glpG research:

  • Addressing conflicting research findings:

    • Modern RAG systems can identify contradictory information in retrieved scientific literature

    • This capability is especially valuable in rapidly evolving fields like membrane biochemistry

    • Researchers can use these systems to highlight inconsistencies in experimental conditions or interpretations across studies

  • Improved literature synthesis:

    • Advanced LLMs can validate context coherence in scientific publications

    • This helps researchers identify genuine scientific controversies versus methodological discrepancies

    • For glpG research, this enables more accurate integration of findings across multiple research groups

  • Standardization of experimental approaches:

    • Context validation in RAG systems helps identify methodological variations

    • These insights can guide efforts to standardize experimental protocols

    • For glpG, this could resolve contradictions in substrate specificity or membrane thickness requirements

  • Knowledge gap identification:

    • Contradiction detection highlights areas where current understanding is incomplete

    • This can guide research prioritization and experimental design

    • For glpG, identified knowledge gaps include physiological substrate identification and regulatory mechanisms

While larger language models generally perform better at contradiction detection, effectiveness varies across different types of contradictions, highlighting the need for specialized approaches when analyzing complex biochemical literature .

How does glpG research interface with therapeutic development for infectious diseases?

The study of bacterial rhomboid proteases like glpG has emerging implications for therapeutic development:

  • Antimicrobial target potential:

    • Rhomboid proteases influence bacterial physiology and potentially virulence

    • Structural differences between bacterial and human rhomboids enable selective targeting

    • Inhibitor development could yield novel antibacterial compounds

  • Cross-application with SARS-CoV-2 research:

    • Recent research on integrin/TGF-β1 inhibitors (e.g., GLPG-0187) shows activity against viral infections

    • While not directly related to glpG, this illustrates how structural insights from one protease family can inform therapeutic approaches for others

  • Experimental paradigms:

    • In vitro reconstitution systems developed for glpG research provide platforms for inhibitor screening

    • Understanding of membrane thickness effects informs drug delivery system design

    • Structure-based computational approaches enable virtual screening

  • Potential combination therapies:

    • Targeting membrane proteases like glpG alongside conventional antibiotics may reduce resistance development

    • Inhibiting proteolytic processing of virulence factors could attenuate pathogenicity without driving resistance

    • Host-directed therapies modulating TGF-β1 signaling could complement direct antimicrobial approaches

These interconnections demonstrate how fundamental research on bacterial membrane proteases contributes to broader therapeutic research paradigms, potentially addressing both bacterial and viral infectious diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.