Recombinant Escherichia coli O127:H6 Tyrosine-protein kinase etk (etk)

Shipped with Ice Packs
In Stock

Description

Occurrence and Homology

All E. coli strains examined possess the etk gene, but only a subset of pathogenic strains express it . Etk is homologous to several bacterial proteins, including Ptk of Acinetobacter johnsonii, AmsA of Erwinia amylovora, and Orf6 of Klebsiella pneumoniae . These proteins are involved in the production of exopolysaccharide (EPS) required for virulence . Like Etk, AmsA and Orf6 are PTKs, suggesting that tyrosine protein phosphorylation in prokaryotes is more common than previously appreciated .

Structure and Function

The crystal structure of the C-terminal kinase domain of E. coli Etk has been determined at 2.5-Å resolution . The fold of the Etk kinase domain differs markedly from that of eukaryotic PTKs . Etk uses a unique two-step activation process involving intra-phosphorylation of a tyrosine residue . The proposed activation mechanism involves the phosphorylated tyrosine residue, Y574, at the active site and its specific interaction with a previously unidentified key arginine residue, R614, to unblock the active site .

Etk can catalyze tyrosine phosphorylation of exogenic substrates, but the genuine physiological exogenic protein substrate remains to be identified . BipA/TypA, an E. coli protein, may be a specific Etk substrate, as recombinant BipA is tyrosine phosphorylated when expressed in enteropathogenic E. coli (EPEC) but not in K12 strains .

Role in Virulence and Antibiotic Resistance

Etk and its homologues define a distinct protein family of prokaryotic membrane-associated PTKs involved in EPS production and virulence . Given its role in bacterial virulence, Etk and similar prokaryotic PTKs may serve as a new target for developing new antibiotics . Studies using structure-guided mutants support the role of Etk in antibiotic resistance .

Activation Mechanism

Etk's activation involves intra-phosphorylation of a tyrosine residue . Mass spectrometry results indicate that all phosphorylation occurred on tyrosine residues, with seven on the C-terminal Y-cluster and one on Y574 . The unique activation mechanism involves the phosphorylated tyrosine residue Y574 at the active site and its specific interaction with arginine residue R614 to unblock the active site .

Involvement in Eukaryotic Cell Signaling

Etk is implicated in the cross-talk between the integrin/FAK and the MyD88 pathways in fibroblast-like synoviocytes (FLS) and in IL-6 synthesis . It plays a major role in LPS- and protein I/II-dependent IL-6 release by activated FLS . Etk is associated with MyD88, FAK, and Mal . Furthermore, Etk is involved in TLR4 signaling in FLS stimulated with LPS .

Role in Cancer

Etk/BMX is upregulated in both human and mouse prostates in response to androgen ablation . Etk expression seems to be differentially regulated by androgen and interleukin 6 (IL-6), which is possibly mediated by the androgen receptor (AR) in prostate cancer cells . Etk expression is elevated in hormone-resistant prostate cancer and positively correlated with tyrosine phosphorylation of AR . Overexpression of Etk in androgen-sensitive LNCaP cells promotes tumor growth, while knocking down Etk expression in hormone-insensitive prostate cancer cells inhibits tumor growth under androgen-depleted conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
etk; E2348C_0966; Tyrosine-protein kinase etk
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-726
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
etk
Target Protein Sequence
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADT LVQVEQKQGNAILSGLSDMIPNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPI VGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGENGHYTLEGEGFTVNGMVGQRL EKDGVALTIADIKAKPGTQFVLSQRTELEAINALQGTFTVSERSKESGMLELTMTGDDPQ LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSV DLNLEAKAVLEQIVNVDNQLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNK RVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQPQPV KPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGAT PDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKV IQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVV GRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY SYSEKE
Uniprot No.

Target Background

Database Links
Protein Families
Etk/wzc family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Escherichia coli O127:H6 Tyrosine-protein kinase etk (Etk)?

Etk is a bacterial protein tyrosine kinase (PTK) found in Escherichia coli O127:H6 and other pathogenic E. coli strains. It belongs to the inner-membrane Wzc/Etk protein family that plays an important function in regulating the polymerization and transport of virulence-determining capsular polysaccharide (CPS). Unlike eukaryotic PTKs, Etk uses a unique two-step activation process involving intra-phosphorylation of tyrosine residues. The full-length protein consists of 726 amino acids and functions as a membrane-associated PTK involved in exopolysaccharide production and virulence .

How does the structure of Etk differ from eukaryotic protein tyrosine kinases?

The crystal structure of the C-terminal kinase domain of Escherichia coli Tyrosine kinase (Etk) has been determined at 2.5-Å resolution, revealing significant structural differences from eukaryotic PTKs. While eukaryotic PTKs share conserved structural elements organized into 11 sub-domains (I-XI), Etk's fold differs markedly. Although there is approximately 20% identity and 40% similarity between a C-terminal segment of Etk and regions in sub-domains I and II of the epidermal growth factor receptor (EGFR), Etk lacks key conserved motifs such as the third glycine in the GXGXXG motif and the conserved lysine in the VAXK sequence. This suggests a distinct evolutionary origin and mechanism of action compared to eukaryotic PTKs .

What is the role of Etk in bacterial pathogenicity?

Etk plays a crucial role in bacterial virulence mechanisms. It is involved in:

  • Regulation of capsular polysaccharide (CPS) production and transport

  • Contribution to antibiotic resistance (particularly polymyxin-B resistance)

  • Exopolysaccharide (EPS) formation, which is critical for host interaction

Expression of Etk is observed only in a subset of pathogenic E. coli strains, including enteropathogenic E. coli (EPEC), enterotoxigenic E. coli (ETEC), and enterohemorrhagic E. coli (EHEC), despite the gene being present in all E. coli strains examined. This selective expression pattern suggests Etk's significant role in virulence mechanisms. In vivo studies with etk-knockout E. coli cells show compromised polymyxin-B resistance, confirming its role in antibiotic resistance .

What is the gene organization and expression pattern of Etk?

The etk gene is present in all E. coli strains but is differentially expressed among pathotypes. Expression analysis reveals:

E. coli Strain/Typeetk Gene PresenceEtk Protein Expression
EPECYesYes
ETECYesYes
EHECYesYes
EAECYesNo
EIECYesNo
E. coli K12YesNo

During EPEC growth, the expression pattern shows that while the level of Etk protein declines upon entering the stationary phase, the levels of the phosphorylated form remain constant. This suggests that only an unphosphorylated subpopulation of Etk is targeted for degradation. Additionally, changes in the mobility of Etk on SDS-PAGE at different growth stages indicate further post-translational modifications in late growth phases .

What is the molecular mechanism of Etk activation and how does it differ from other kinases?

Etk employs a unique activation mechanism that differs fundamentally from eukaryotic PTKs. Based on crystallographic and mass spectrometric evidence, the activation involves:

  • Initial blockage of the active site by the unphosphorylated tyrosine residue Y574

  • Autophosphorylation of Y574

  • Interaction of phosphorylated Y574 with a key arginine residue (R614)

  • Unblocking of the active site, enabling kinase activity

This mechanism has been verified through both in vitro kinase activity assays and in vivo antibiotic resistance studies using structure-guided mutants. Mutations that affect this P-Y574-R614 interaction (Y574F, Y574N, R614A) show reduced polymyxin-B resistance compared to wild-type or mutants that maintain the interaction (Y574A, Y574E, R614K) .

How do mutations in critical residues affect Etk function in experimental systems?

Structure-guided mutations in key residues have provided significant insights into Etk function:

MutationEffect on StructureEffect on ActivityEffect on Polymyxin-B Resistance
Y574AAbsence of steric hindranceEnhancedHigher
Y574EMimics phosphorylation (always switched-on)EnhancedHigher
R614KMaintains P-Y574 interactionSimilar to wild-typeHigher
Y574FCannot be phosphorylatedCompromisedLower
Y574NDisrupts P-Y574-R614 interactionCompromisedLower
R614AEliminates key interaction partnerCompromisedLower

These findings demonstrate that the P-Y574-R614 interaction is critical for Etk activation. Mutations that prevent Y574 phosphorylation or disrupt the interaction with R614 result in reduced kinase activity and decreased polymyxin-B resistance in vivo .

How is Etk activity regulated in the context of capsular polysaccharide production?

Etk activity regulation is closely tied to capsular polysaccharide production in pathogenic E. coli. The regulatory mechanisms include:

  • Growth phase-dependent expression: Etk levels decline upon entering stationary phase, but phosphorylated forms remain constant

  • Selective degradation: Evidence suggests unphosphorylated Etk is preferentially targeted for degradation

  • Post-translational modifications: Changes in Etk mobility on SDS-PAGE during late growth phases indicate additional modifications beyond phosphorylation

  • Cross-talk with other virulence mechanisms: Etk expression appears inversely correlated with type III secretion system transcription in EHEC O157:H7

Importantly, enteropathogenic E. coli O127 forms a capsule from the same strain-specific O-antigen repeats found in their lipopolysaccharide (LPS). Seven genes encoding capsule export functions comprise the group 4 capsule (gfc) operon, where Etk works together with other proteins like GfcE and Etp. This O-antigen capsule has been shown to protect EPEC O127 from human alpha-defensin 5, highlighting its role in immune evasion .

What is the relationship between Etk and homologous proteins in other bacterial pathogens?

Etk belongs to a family of prokaryotic membrane-associated PTKs involved in exopolysaccharide production and virulence. Key homologous relationships include:

ProteinOrganismSimilarity to EtkFunction
PtkAcinetobacter johnsoniiHomologousFirst identified prokaryotic PTK
AmsAErwinia amylovoraCross-reacts with anti-Etk and anti-phosphotyrosine antibodiesRequired for EPS production and plant virulence
Orf6Klebsiella pneumoniae K2Cross-reacts with anti-Etk and anti-phosphotyrosine antibodiesRequired for K2 capsule formation and resistance to phagocytosis

In E. amylovora, amsA mutants show reduced EPS production and attenuated virulence on immature pear fruits. In K. pneumoniae K2, non-capsulated mutants lacking Orf6 are much more sensitive to phagocytosis, with LD50 values reduced by more than three orders of magnitude compared to wild-type strains. These findings highlight the conserved role of this protein family in virulence across different bacterial pathogens .

What are the optimal conditions for recombinant expression and purification of Etk?

For recombinant expression and purification of full-length Etk protein:

  • Expression System:

    • Host: BL21(DE3) E. coli cells

    • Culture medium: Terrific Broth with 100 μg/ml ampicillin

    • Induction: 0.1 mM isopropyl β-D-thiogalactoside at room temperature overnight

  • Purification Protocol:

    • Lyse cells in 50 mM phosphate buffer (pH 8.5) and 300 mM NaCl

    • Purify using nickel nitrilotriacetate agarose affinity chromatography

    • Elute with 150 mM imidazole

    • Dialyze into Tris buffer (pH 9.5)

    • Further purify using size-exclusion chromatography (HiLoad 26/60, Superdex 200)

    • Collect the monomeric fraction

    • Final dialysis into 100 mM Tris buffer (pH 9.5) with 300 mM NaCl

    • Concentrate to ~20 mg/ml for crystallization or other applications

For selenomethionine-substituted Etk (useful for structural studies), express the protein in the metA- E. coli strain DL41 in LeMaster medium .

How can the kinase activity of Etk be measured in experimental settings?

Etk kinase activity can be assessed through several complementary approaches:

  • Autophosphorylation Assay:

    • Incubate purified Etk (~5 μg) in reaction buffer containing 10 μCi of [γ-32P] ATP

    • After 5 minutes at room temperature, precipitate proteins with 20% tetrachloric acid (TCA)

    • Wash precipitates twice with TCA

    • Resuspend in standard Gly SDS buffer and measure radioactivity

    • Calculate specific activity as the count ratio between the protein sample and the reaction mixture

  • Phosphorylation of Exogenous Substrates:

    • Use synthetic co-polymer poly(Glu:Tyr) as a substrate

    • Perform similar radiometric assays as for autophosphorylation

  • Dephosphorylation Assay:

    • To confirm tyrosine phosphorylation, treat purified phosphorylated Etk with YopH (a specific tyrosine protein phosphatase)

    • Stop the reaction at various time points (30, 60, and 90 seconds) by adding Na3VO4

    • Analyze by immunoblotting with anti-phosphotyrosine antibodies

  • Mass Spectrometry:

    • Use to identify phosphorylation sites precisely

    • Can provide evidence for the phosphorylation status of specific residues (e.g., Y574) .

What approaches can be used to investigate the role of Etk in bacterial pathogenicity?

To investigate Etk's role in pathogenicity, researchers can employ:

  • Gene Knockout Studies:

    • Create etk-knockout strains using targeted gene deletion

    • Complement with wild-type or mutant versions for functional rescue experiments

    • Assess phenotypes such as capsule formation, antibiotic resistance, and virulence

  • Antibiotic Resistance Assays:

    • Test polymyxin-B resistance (a key phenotype linked to Etk function)

    • Compare wild-type, knockout, and complemented strains

    • Protocol: Dilute overnight cultures to OD600 of 0.10 with 10 μM IPTG and 1.2 μg/ml polymyxin-B

    • Incubate at 37°C for 16 hours and measure OD600

    • Verify protein expression by western blotting using anti-His and goat anti-rabbit antibodies

  • Capsule/EPS Visualization and Quantification:

    • Use electron microscopy to visualize capsule formation

    • Apply biochemical methods to quantify EPS production

    • Compare wild-type and mutant strains

  • Structure-Function Analysis:

    • Create point mutations in key residues (e.g., Y574, R614)

    • Express mutant proteins in knockout strains

    • Assess both in vitro kinase activity and in vivo phenotypes .

What are the optimal storage and handling conditions for recombinant Etk protein?

For optimal stability and activity of recombinant Etk protein:

  • Storage Conditions:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

    • Repeated freezing and thawing is not recommended

  • Storage Buffer:

    • Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Reconstitution Protocol:

    • Briefly centrifuge vial prior to opening to bring contents to the bottom

    • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% of glycerol (final concentration) and aliquot for long-term storage

    • Default final concentration of glycerol is 50%

  • Form and Handling:

    • Supplied as a lyophilized powder

    • Purity is typically greater than 90% as determined by SDS-PAGE

    • Handle at appropriate biosafety level according to institutional guidelines .

How can structural data on Etk be analyzed to understand its unique activation mechanism?

Analysis of Etk structural data reveals crucial insights into its activation mechanism:

  • Crystallographic Analysis:

    • The 2.5-Å resolution crystal structure of Etk's kinase domain provides the foundation for understanding its activation

    • Structural comparison with eukaryotic PTKs highlights the unique fold of Etk

    • Analysis of the active site reveals the positioning of Y574 and its interaction with R614 upon phosphorylation

  • Structure-Based Mutational Analysis:

    • Design mutations based on structural data (e.g., Y574A, Y574F, R614A)

    • Correlate structural changes with functional outcomes

    • Use molecular modeling to predict the effects of mutations on protein conformation and activity

  • Molecular Dynamics Simulations:

    • Simulate the conformational changes associated with Y574 phosphorylation

    • Model the interaction between P-Y574 and R614

    • Predict the dynamic behavior of wild-type and mutant proteins

  • Integration with Biochemical Data:

    • Combine structural insights with mass spectrometry data confirming phosphorylation sites

    • Correlate in vitro kinase activity with structural features

    • Link structural elements to in vivo phenotypes such as polymyxin-B resistance .

What approaches can be used to identify potential inhibitors of Etk for therapeutic development?

Given Etk's role in bacterial virulence, identifying inhibitors could lead to novel therapeutic approaches:

  • Structure-Based Drug Design:

    • Use the 2.5-Å resolution crystal structure as a template

    • Focus on the unique ATP-binding pocket and activation mechanism

    • Identify small molecules that can interfere with the P-Y574-R614 interaction

    • Design compounds that selectively target bacterial PTKs without affecting eukaryotic kinases

  • High-Throughput Screening:

    • Develop robust kinase activity assays suitable for screening

    • Screen chemical libraries for compounds that inhibit Etk activity

    • Identify hit compounds for further optimization

  • Validation Approaches:

    • Test candidate inhibitors against purified Etk in vitro

    • Assess effects on bacterial growth, capsule formation, and antibiotic resistance

    • Evaluate specificity by testing against other bacterial and eukaryotic kinases

    • Determine mechanism of action through biochemical and structural studies

  • Combination Strategies:

    • Test Etk inhibitors in combination with existing antibiotics

    • Assess potential for synergy, particularly with polymyxin antibiotics

    • Evaluate effectiveness against antibiotic-resistant strains .

What are the most significant unanswered questions about Etk function and regulation?

Despite considerable progress in understanding Etk, several important questions remain:

  • Physiological Substrates:

    • While Etk can phosphorylate synthetic substrates like poly(Glu:Tyr), its genuine physiological protein substrates remain incompletely characterized

    • BipA/TypA is a potential specific Etk substrate, but further confirmation is needed

    • Identification of the complete set of Etk substrates would provide deeper insights into its role in virulence

  • Regulatory Networks:

    • The molecular basis for differential expression of etk between different E. coli strains is not fully understood

    • How Etk activity is integrated with other virulence mechanisms requires further investigation

    • The stimuli that trigger Etk activation in vivo remain to be identified

  • Structural Dynamics:

    • The complete mechanism of autophosphorylation is not fully elucidated

    • How membrane association affects Etk function remains to be determined

    • The structural basis for substrate recognition needs further characterization

  • Therapeutic Potential:

    • Whether Etk inhibition can effectively reduce virulence in animal infection models

    • Feasibility of developing selective inhibitors of bacterial PTKs without affecting host kinases

    • Potential for resistance development against Etk-targeting therapeutics .

How can emerging technologies advance our understanding of Etk in bacterial pathogenesis?

Emerging technologies offer new opportunities to address outstanding questions:

  • CRISPR-Cas9 Genome Editing:

    • Create precise mutations in the etk gene in various pathogenic E. coli strains

    • Generate conditional knockouts to study Etk function at different stages of infection

    • Implement base editing to modify specific nucleotides without double-strand breaks

  • Single-Cell Analysis:

    • Investigate heterogeneity in Etk expression and phosphorylation within bacterial populations

    • Correlate Etk activity with virulence gene expression at the single-cell level

    • Study dynamics of Etk activation during host-pathogen interactions

  • Cryo-Electron Microscopy:

    • Determine structures of full-length Etk, including the membrane-spanning domain

    • Visualize Etk in complex with substrates and regulatory partners

    • Study conformational changes associated with activation

  • Host-Pathogen Models:

    • Develop advanced organoid models to study Etk function during infection

    • Use intravital microscopy to visualize Etk-dependent processes during infection in vivo

    • Apply systems biology approaches to understand Etk's role in the context of the complete virulence network .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.