Recombinant Escherichia coli O127:H6 UPF0059 membrane protein yebN (yebN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of the product is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; yebN; E2348C_1945; Probable manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
mntP
Target Protein Sequence
MNITATILLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEQPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of E. coli O127:H6 UPF0059 membrane protein yebN?

YebN is a membrane protein belonging to the UPF0059 family, characterized by a structure likely similar to that observed in other E. coli strains. Based on amino acid sequence analysis from related strains, yebN typically contains multiple transmembrane domains with hydrophobic regions that anchor it within the bacterial membrane. The protein sequence generally consists of approximately 188 amino acids with predicted transmembrane helices and potential cytoplasmic and periplasmic domains. Structural analysis techniques including circular dichroism spectroscopy and light-scattering methods would be recommended for detailed characterization, similar to approaches used for other E. coli membrane proteins .

How does yebN differ between E. coli O127:H6 and other E. coli strains?

Strain-specific variations in yebN can be identified through sequence alignment and functional comparison studies. While the core structure and function may be conserved, differences may exist in specific amino acid residues that could affect protein-protein interactions or functional efficiency. For comprehensive analysis, researchers should perform multiple sequence alignments using tools like Clustal Omega or MUSCLE, followed by identification of conserved domains and variable regions. Comparison with the yebN protein from E. coli O81 strain suggests potential similarities in the transmembrane domains, but strain-specific variations may occur particularly in the loop regions exposed to the periplasmic or cytoplasmic space .

What is the current understanding of yebN function in bacterial membrane biology?

As a UPF0059 family membrane protein, yebN is likely involved in membrane transport processes, though its precise substrate specificity and regulatory mechanisms remain subjects of investigation. Current research suggests potential roles in ion transport, stress response, or membrane integrity maintenance. To investigate its function, knockout studies combined with phenotypic assays under various stress conditions would be recommended. Additionally, protein interaction studies using methods such as bacterial two-hybrid systems or co-immunoprecipitation could identify binding partners that provide functional insights.

What are the optimal expression systems for recombinant production of E. coli O127:H6 yebN?

For effective expression of yebN, consideration of expression vector, host strain, and induction conditions is crucial. A methodological approach involves:

  • Vector selection: pET-based vectors with T7 promoter systems offer strong, inducible expression suitable for membrane proteins. Alternative systems including pBAD (arabinose-inducible) or pTac (IPTG-inducible) may provide more controlled expression to minimize toxicity.

  • Host strain selection: E. coli strains specialized for membrane protein expression such as C41(DE3), C43(DE3), or Lemo21(DE3) typically yield better results than standard BL21(DE3) for membrane proteins like yebN.

  • Expression conditions:

    • Temperature: Lower temperatures (16-25°C) often improve proper folding

    • Induction: Low inducer concentrations (0.1-0.5 mM IPTG) applied during mid-log phase

    • Media: Enriched media (2YT or Terrific Broth) supplemented with appropriate antibiotics

  • Scale-up considerations: Initial small-scale expression tests should be conducted to optimize conditions before scaling to larger volumes required for structural or functional studies .

What strategies overcome common challenges in purifying yebN membrane protein?

Purification of membrane proteins like yebN presents significant challenges due to their hydrophobicity and susceptibility to aggregation. A systematic approach involves:

  • Membrane isolation: Differential centrifugation to isolate bacterial membranes followed by selective extraction using detergents.

  • Detergent selection: Testing a panel of detergents is critical for successful solubilization:

Detergent TypeExamplesTypical ConcentrationBest Applications
Mild non-ionicDDM, LMNG1-2% for extraction, 0.05-0.1% for purificationInitial solubilization
ZwitterionicLDAO, FC-120.5-2% for extraction, 0.05-0.2% for purificationEnhanced solubilization
Peptide-basedSMA, amphipolsVariousDetergent-free approaches
  • Affinity purification: Incorporating affinity tags (His6, FLAG, etc.) enables efficient isolation through affinity chromatography. For yebN, C-terminal tags are often preferred to avoid interference with signal peptides.

  • Purification refinement: Size exclusion chromatography to assess protein homogeneity and remove aggregates or impurities.

  • Stability enhancement: Buffer optimization including pH screening (typically pH 7-8), salt concentration (100-500 mM NaCl), and stabilizing additives (glycerol 5-10%) .

How can researchers verify the correct folding and functionality of purified recombinant yebN?

Assessment of properly folded and functional yebN requires multiple complementary approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

    • Thermal stability assays (DSF/nanoDSF) to assess protein stability

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm monodispersity and molecular weight

  • Functional verification:

    • Reconstitution into proteoliposomes or nanodiscs for transport assays

    • Substrate binding assays using isothermal titration calorimetry or microscale thermophoresis

    • Protein-protein interaction studies if binding partners are known

  • Structural validation:

    • Limited proteolysis to examine accessible cleavage sites

    • Hydrogen-deuterium exchange mass spectrometry to evaluate solvent accessibility

These approaches provide complementary information about protein conformation and functionality, essential for confirming successful recombinant protein production .

What are the most effective membrane mimetic systems for studying yebN structure?

Selection of appropriate membrane mimetics is critical for structural and functional studies of yebN:

Mimetic SystemAdvantagesLimitationsBest Applications
Detergent micellesSimple preparation, compatible with many techniquesMay not fully replicate native environmentInitial characterization, crystallography
NanodiscsDefined size, bilayer structureComplex assembly, potential interference from scaffold proteinsNMR, cryo-EM, functional studies
LiposomesNative-like bilayer, suitable for functional assaysHeterogeneous size, challenging for structural studiesTransport assays, electrophysiology
BicellesOrdered bilayer regions, compatible with solution NMRLimited stability, narrow composition rangeSolution NMR studies
AmphipolsEnhanced stability, detergent-freeComplex preparationCryo-EM, spectroscopic methods

For yebN, researchers should initially test DDM or LMNG detergent micelles for extraction and purification, followed by reconstitution into nanodiscs or liposomes for functional studies. Methodology should include detergent screening using thermal stability assays to identify conditions that maintain protein stability .

How can researchers determine the membrane topology of yebN?

Determining membrane topology is essential for understanding yebN function. A comprehensive approach combines:

  • Computational prediction:

    • Transmembrane prediction algorithms (TMHMM, TOPCONS, Phobius)

    • Hydropathy plot analysis to identify hydrophobic transmembrane regions

  • Biochemical mapping:

    • Cysteine accessibility methods: introducing cysteine residues at predicted loops followed by chemical labeling

    • Protease protection assays to identify exposed regions

    • Fluorescence labeling of termini and loops

  • Structural biology techniques:

    • Cryo-electron microscopy for direct visualization

    • X-ray crystallography if diffraction-quality crystals can be obtained

    • NMR spectroscopy for dynamics and topology information

  • Reporter fusion systems:

    • PhoA/LacZ dual reporter fusions at different positions

    • GFP-based topology mapping

This multifaceted approach provides convergent evidence for topology determination, overcoming limitations of individual methods .

What experimental approaches can determine yebN's potential role in membrane transport?

To investigate yebN's transport function, researchers should employ:

  • Reconstitution systems:

    • Proteoliposome-based transport assays with fluorescent or radioactive substrates

    • Electrophysiology (patch-clamp or planar lipid bilayer recordings) for ion channel/transporter characterization

    • Stopped-flow spectroscopy for kinetic measurements

  • Cellular assays:

    • Survival assays under various stress conditions comparing wild-type and yebN-knockout strains

    • Differential ion/small molecule accumulation assays

    • Growth complementation studies in defined media

  • Binding studies:

    • Isothermal titration calorimetry (ITC) to measure binding affinity to potential substrates

    • Microscale thermophoresis for detecting interactions with small molecules

    • Surface plasmon resonance for real-time binding kinetics

  • Structural studies with bound substrates:

    • Co-crystallization with potential substrates or inhibitors

    • Hydrogen-deuterium exchange mass spectrometry to identify substrate-induced conformational changes

Data analysis should include comparison of transport kinetics (Km, Vmax) across different conditions and substrates to identify specificity patterns .

How does yebN interact with other membrane proteins in E. coli O127:H6?

Investigating protein-protein interactions of yebN requires multiple complementary approaches:

  • In vivo interaction studies:

    • Bacterial two-hybrid assays

    • FRET/BRET-based interaction detection

    • Co-immunoprecipitation with antibodies against native proteins or epitope tags

  • In vitro interaction analysis:

    • Pull-down assays with purified components

    • Crosslinking studies followed by mass spectrometry

    • Isothermal titration calorimetry or biolayer interferometry for quantitative binding parameters

    • Size exclusion chromatography with multi-angle light scattering to detect complex formation

  • Structural studies of complexes:

    • Cryo-electron microscopy of membrane protein complexes

    • Crosslinking coupled with mass spectrometry (XL-MS) to identify interaction interfaces

Similar to studies with other E. coli membrane protein complexes, researchers should quantify binding affinities and identify interaction domains through systematic mutagenesis of potential interface residues. The GfcB-GfcC-GfcD interaction system in E. coli O127 provides a precedent for such studies, where high-affinity heterodimer formation (KD ~100 nM) was observed between two components with weaker interactions to a third component (KD = 28 μM) .

How can CRISPR-Cas9 genome editing be applied to study yebN function in E. coli O127:H6?

CRISPR-Cas9 technology offers powerful approaches for investigating yebN function through precise genomic modifications:

  • Gene knockout studies:

    • Design sgRNAs targeting the yebN gene with minimal off-target effects

    • Introduce frameshift mutations or complete gene deletions

    • Create clean knockouts using scarless editing strategies

  • Domain mapping:

    • Generate truncations or internal deletions to map functional domains

    • Introduce point mutations at conserved residues to identify essential amino acids

    • Create chimeric proteins by domain swapping with related transporters

  • Conditional expression systems:

    • Integrate inducible promoters upstream of yebN for controlled expression

    • Develop CRISPRi systems for tunable repression of yebN expression

  • Reporter integrations:

    • Introduce fluorescent protein fusions at the genomic locus

    • Create transcriptional/translational reporters to monitor expression

  • High-throughput screening:

    • Generate CRISPR libraries targeting yebN with various mutations

    • Develop selection systems based on predicted yebN functions

Implementation should include appropriate controls and phenotypic characterization under various stress conditions to identify functional consequences of genetic modifications .

What computational approaches can predict substrate specificity and functional mechanisms of yebN?

Advanced computational methods provide valuable insights into yebN function:

  • Homology modeling and structural prediction:

    • Generate 3D models based on related proteins with solved structures

    • Use AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Refine models with molecular dynamics simulations in membrane environments

  • Molecular dynamics simulations:

    • All-atom simulations in explicit membrane environments to study conformational dynamics

    • Enhanced sampling methods to explore conformational transitions

    • Potential of mean force calculations to estimate energetics of transport processes

  • Substrate docking and transport pathway identification:

    • Virtual screening of potential substrates using molecular docking

    • Identification of binding pockets and transport pathways

    • Calculation of binding free energies for potential substrates

  • Evolutionary analysis:

    • Sequence coevolution analysis to identify functionally coupled residues

    • Phylogenetic analysis across bacterial species to trace functional divergence

    • Comparative genomics to identify conserved genomic context

These computational approaches should be validated with experimental data whenever possible, creating an iterative process of prediction and verification .

How might yebN contribute to the pathogenicity of enteropathogenic E. coli O127:H6?

Investigating yebN's potential role in pathogenesis requires integrating membrane protein research with infection biology:

  • Infection models:

    • Compare wild-type and yebN-deficient strains in cell culture infection models

    • Assess adherence, invasion, and intracellular survival capabilities

    • Evaluate effects on host cell signaling and inflammatory responses

  • Virulence factor regulation:

    • Examine how yebN affects expression of known virulence factors

    • Investigate potential contribution to stress resistance during host colonization

    • Study interaction with regulatory systems controlling virulence expression

  • Host-pathogen interface:

    • Analyze whether yebN is involved in host cell recognition or adhesion

    • Determine if yebN interacts with host membrane components

    • Investigate potential immunomodulatory effects

  • Biofilm formation:

    • Compare biofilm formation capacity between wild-type and yebN-mutant strains

    • Evaluate extracellular matrix composition in biofilms

    • Test antimicrobial susceptibility in biofilm vs. planktonic states

Enteropathogenic E. coli O127 is known to be encapsulated by a protective polysaccharide layer, and membrane proteins may play roles in capsule assembly or function. The group 4 capsule (gfc) operon in E. coli O127 encodes proteins that assemble at the outer membrane, suggesting potential functional relationships with other membrane proteins like yebN that warrant investigation .

How does yebN expression change under different environmental conditions relevant to infection?

Understanding yebN regulation during infection requires systematic analysis of expression patterns:

  • Transcriptomic analysis:

    • RNA-seq under conditions mimicking different infection stages

    • Comparison of expression in standard laboratory media vs. host-mimicking conditions

    • Identification of co-regulated genes to place yebN in regulatory networks

  • Proteomic quantification:

    • Targeted proteomics (SRM/MRM) to quantify yebN protein levels

    • Comparative membrane proteomics across growth conditions

    • Post-translational modification analysis

  • Reporter systems:

    • Transcriptional/translational fusions to monitor expression in real-time

    • Single-cell analysis to detect population heterogeneity

    • In vivo imaging during infection process if animal models are applicable

  • Regulatory network mapping:

    • ChIP-seq to identify transcription factors binding to yebN promoter

    • Promoter dissection to identify regulatory elements

    • Epistasis analysis with known regulators of virulence

These approaches allow construction of comprehensive models of yebN regulation in response to environmental signals encountered during infection, potentially revealing its role in bacterial adaptation to host environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.