Recombinant Escherichia coli O127:H6 UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Description

Definition and Identification

The recombinant Escherichia coli O127:H6 UPF0259 membrane protein yciC (UniProt ID: B7UQE6) is a bioengineered version of the native yciC protein expressed in E. coli. It belongs to the UPF0259 family of uncharacterized proteins, which are conserved across bacterial species. The recombinant form is His-tagged and retains full-length or partial sequences (1–247 amino acids) depending on production protocols .

Key Features:

PropertyValue
Source OrganismE. coli O127:H6 (strain E2348/69, a model pathogen in enteropathogenic E. coli studies)
Expression HostE. coli
TagN-terminal His-tag
Molecular Weight~26.3 kDa (predicted for full-length)
Purity>85% (SDS-PAGE)

Functional Studies

  • Membrane Protein Insertion: While not directly linked to YidC (a well-characterized insertase), yciC’s membrane localization suggests potential involvement in protein folding or lipid interactions .

  • Zinc Homeostasis: Homologs in Bacillus subtilis (yciC) function as metallochaperones, regulated by Zur (zinc uptake regulator) . In E. coli, similar regulatory mechanisms may exist, though direct evidence is lacking.

Immunological Tools

  • ELISA and Antibody Production: Recombinant yciC serves as an antigen in ELISA assays for detecting antibodies or studying immune responses .

  • Antibody Specificity: Polyclonal rabbit antibodies against yciC are validated for immunoblotting and immunoprecipitation .

Potential Roles

  1. Metal Ion Regulation: Analogous to Bacillus yciC, it may assist in zinc trafficking or detoxification .

  2. Membrane Stability: Could stabilize membrane proteins or lipids during stress .

Unresolved Questions

  • Mechanistic Role: No experimental data directly links yciC to specific biochemical pathways in E. coli.

  • Pathogenic Relevance: While E. coli O127:H6 is a model pathogen, yciC’s contribution to virulence remains unexplored .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, please specify them when placing your order, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us and we will prioritize developing the product with your specified tag.
Synonyms
yciC; E2348C_1382; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
yciC
Target Protein Sequence
MSITAQSVYRDTGNFFRNQFVTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS SGLFDLVQNMSPEQQQILLQASAASTFSGLIGNAILAGGVILIIQLVSAGQRVSALRAIG ASAPILPKLFILIFLTTLLVQIGIMLVVVPGIIMAILLALAPVMLVQDKMGVFASMRSSM RLTWANIRLVAPAVLSWLLAKTLLLLFASSFAALTPAIGAVLANTLSNLISAVLLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0259 membrane protein yciC and what is its predicted structure?

The UPF0259 membrane protein yciC in E. coli O127:H6 is a transmembrane protein belonging to the UPF0259 family (Uncharacterized Protein Family 0259). Based on homology to related proteins such as the Salmonella newport UPF0259 membrane protein yciC, it likely consists of approximately 247 amino acids with multiple membrane-spanning domains .

Structurally, yciC is predicted to have several transmembrane helices that anchor it within the bacterial cell membrane. The protein likely contains hydrophobic regions that span the lipid bilayer interspersed with hydrophilic loops extending into either the cytoplasm or periplasm. While the exact three-dimensional structure remains to be determined experimentally, modern structural prediction tools suggest it may form a hydrophilic groove similar to other membrane protein insertases, potentially allowing interaction with other membrane components or facilitating transport functions.

How conserved is yciC across different bacterial species?

The yciC protein demonstrates significant conservation across various bacterial species, particularly among Enterobacteriaceae. Sequence analysis reveals that homologs exist in multiple pathogenic and non-pathogenic bacteria, suggesting an important functional role that has been preserved throughout bacterial evolution.

The highest sequence conservation is typically observed in the transmembrane domains and potential functional motifs, while loop regions often show greater variability. This pattern of conservation provides valuable insights into which regions might be essential for the protein's core function. The Salmonella newport homolog, for instance, shows substantial sequence similarity to the E. coli O127:H6 version, with the full-length protein (amino acids 1-247) likely sharing similar structural characteristics .

What expression system is most appropriate for producing functional recombinant yciC?

For the expression of functional recombinant yciC, E. coli-based expression systems typically offer the most practical starting point, particularly for a bacterial membrane protein. Based on successful approaches with similar membrane proteins, the following expression system considerations are recommended:

For the actual construct design, incorporating an N-terminal histidine tag has proven effective for the related Salmonella newport UPF0259 membrane protein, facilitating purification while maintaining protein functionality . When designing the expression vector, it's advisable to include a TEV or PreScission protease cleavage site to enable tag removal if needed for subsequent functional studies.

Growth conditions significantly impact membrane protein expression quality. For E. coli O127:H6 proteins, research on flagellar gene expression has shown that environmental and nutritional signals strongly influence gene expression . Therefore, optimize temperature (typically lower temperatures of 16-25°C after induction), media composition (consider rich media like Terrific Broth), and induction parameters (lower IPTG concentrations of 0.1-0.5 mM).

What is the most effective method for purifying recombinant yciC while maintaining its native conformation?

Purification of recombinant yciC requires specialized approaches to maintain the protein's native conformation throughout the process. A methodical purification workflow should include:

  • Membrane isolation and solubilization: After cell lysis (typically using mechanical methods such as sonication or French press), isolate membrane fractions through ultracentrifugation. Solubilize membranes using mild detergents such as n-Dodecyl β-D-maltoside (DDM), Lauryl Maltose Neopentyl Glycol (LMNG), or digitonin at concentrations 2-3 times their critical micelle concentration (CMC).

  • Affinity chromatography: For His-tagged constructs (similar to the Salmonella homolog), use immobilized metal affinity chromatography (IMAC) with Ni-NTA or TALON resins . Include low concentrations of detergent in all buffers to prevent protein aggregation.

  • Size exclusion chromatography: This crucial step separates properly folded monomeric protein from aggregates and improves purity. Recommended buffers typically contain 20-50 mM Tris or HEPES (pH 7.5), 150-300 mM NaCl, and detergent at 2-3× CMC.

  • Quality assessment: Verify purity using SDS-PAGE (aim for >90% purity as described for the Salmonella homolog) and confirm protein identity through western blotting or mass spectrometry.

For storage, the protein can be maintained in buffer containing glycerol (10-20%) at -80°C, or lyophilized as described for the Salmonella homolog . When reconstituting from lyophilized powder, use deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL, and consider adding 5-50% glycerol for long-term storage stability .

How should I design experiments to investigate yciC function in membrane transport?

Investigating the potential membrane transport function of yciC requires a multi-faceted experimental design approach that combines genetic, biochemical, and biophysical methods:

  • Genetic approaches:

    • Generate yciC knockout strains using CRISPR-Cas9 or homologous recombination

    • Create point mutations in conserved residues to identify functional domains

    • Develop complementation assays to confirm phenotypes are specifically due to yciC disruption

  • Transport assay design:

    • Reconstitute purified yciC into proteoliposomes with defined lipid composition

    • Incorporate fluorescent or radioactive tracers inside liposomes to monitor potential transport

    • Test various conditions (pH, temperature, ion gradients) to identify transport parameters

    • Include proper controls: empty liposomes, liposomes with unrelated membrane proteins, and known transporters

  • Interaction studies:

    • Perform co-immunoprecipitation to identify interaction partners

    • Use bacterial two-hybrid systems to validate specific protein-protein interactions

    • Employ cross-linking approaches followed by mass spectrometry to map interaction interfaces

Environmental factors should be carefully controlled in these experiments, as research on E. coli O127:H6 has demonstrated that gene expression and protein function are significantly affected by environmental conditions . Consider testing multiple media types, as flagellar gene expression in E. coli O127:H6 varies dramatically between growth in Luria-Bertani (LB) medium versus Dulbecco's Minimal Essential Medium (DMEM) .

What controls should I include when studying yciC function in vitro?

Robust experimental design for investigating yciC function requires carefully selected controls at multiple levels:

Control TypePurposeExamples
Protein-level controlsVerify specificity of observed effects- Denatured yciC (negative control)
- Related membrane protein from same family
- Tag-only construct (to rule out tag effects)
System validation controlsEnsure experimental system is working properly- Known transporter with established function
- Positive controls specific to each assay type
Specificity controlsConfirm substrate specificity- Structurally similar non-substrate molecules
- Competitive inhibitors if known
System integrity controlsVerify experimental system integrity- Liposome integrity markers
- Membrane permeability controls
Environmental controlsAccount for environmental influences- pH controls
- Temperature controls
- Buffer composition controls

When working with recombinant proteins, it's essential to follow NIH guidelines for research involving recombinant or synthetic nucleic acid molecules, which specify biosafety practices and containment principles . These guidelines are particularly important when expressing and purifying membrane proteins that might influence bacterial virulence or pathogenicity.

How does environmental stress affect the expression and function of yciC?

Environmental stress likely plays a significant role in regulating yciC expression and function, similar to other membrane proteins in E. coli O127:H6. Research on flagellar gene expression in this strain has demonstrated that environmental and nutritional signals significantly affect gene transcription patterns .

Multiple environmental factors may influence yciC expression and function:

  • pH effects: Changes in environmental pH could trigger conformational changes in yciC or alter its expression levels. Research on E. coli O127:H6 has shown that pH is a critical regulator of flagellar gene expression , suggesting that similar mechanisms might control yciC.

  • Nutrient availability: The carbon and nitrogen sources available to bacteria significantly impact membrane protein expression. In E. coli O127:H6, flagellar gene expression varies dramatically depending on growth medium - being repressed in Dulbecco's Minimal Essential Medium (DMEM) but activated in Luria-Bertani (LB) medium . Similar media-dependent regulation might apply to yciC.

  • Oxygen tension: Aerobic versus anaerobic conditions likely affect yciC expression and function, particularly if it plays a role in respiration or adapting to different oxygen environments.

  • Temperature: As a membrane protein, yciC structure and function are likely temperature-sensitive, with potential regulatory mechanisms responding to temperature changes during infection.

To study these effects experimentally, researchers should design experiments that systematically vary these environmental parameters while monitoring yciC expression (using qRT-PCR or reporter constructs) and function (through activity assays once the protein's function is better characterized).

What challenges are associated with crystallizing recombinant yciC for structural studies?

Obtaining crystal structures of membrane proteins like yciC presents numerous challenges that require specialized approaches:

  • Inherent challenges of membrane protein crystallization:

    • Hydrophobic surfaces reduce crystal contact formation

    • Detergent micelles can interfere with crystal packing

    • Conformational heterogeneity reduces crystal order

    • Lower expression yields limit material availability

  • Strategic approaches to overcome these challenges:

    a. Construct optimization:

    • Design multiple constructs with varying N- and C-terminal boundaries

    • Consider fusion proteins (T4 lysozyme, BRIL) to increase polar surface area

    • Introduce surface mutations to enhance crystallizability

    b. Detergent and lipid screening:

    • Test multiple detergents (DDM, DM, LMNG, etc.)

    • Include specific lipids that may stabilize native conformation

    • Consider novel approaches like lipidic cubic phase crystallization

    c. Crystal screening optimization:

    • Implement high-throughput crystallization trials

    • Test wide ranges of pH, salt concentrations, and precipitants

    • Consider additives that stabilize specific conformations

  • Alternative approaches:

    • Cryo-electron microscopy (cryo-EM) for structure determination without crystallization

    • NMR studies of specific domains or fragments

    • Computational approaches combined with experimental constraints

For successful structural studies, protein sample quality is paramount. The recombinant protein should achieve >90% purity as determined by SDS-PAGE (similar to standards for the Salmonella homolog) and demonstrate biochemical homogeneity through size-exclusion chromatography.

How can I interpret contradictory results from different functional assays of yciC?

Contradictory results are common when studying complex membrane proteins like yciC and require systematic troubleshooting and thoughtful interpretation:

  • Methodological considerations:

    • Different detergents may affect protein conformation and activity differently

    • Buffer conditions (pH, salt concentration) can significantly impact results

    • Protein orientation in reconstituted systems may vary between experiments

    • Tag position (N- versus C-terminal) might interfere with specific functions

  • Biological explanations for contradictions:

    • yciC may have multiple functional states or conformations

    • The protein might have different functions under different conditions

    • Interactions with other proteins may be required for certain functions

    • Post-translational modifications might regulate activity

  • Resolution strategies:

    Contradiction TypeInvestigation ApproachTechniques
    Activity in different detergentsDetergent screening with activity correlationActivity assays in multiple detergents with stability measurements
    In vitro vs. in vivo discrepanciesIdentify missing cellular factorsPull-down assays, co-expression studies
    Substrate specificity conflictsTest multiple potential substratesBinding assays, transport measurements with various candidates
    Condition-dependent activitySystematically vary conditionspH, temperature, ionic strength titrations
  • Integrative approach: When faced with contradictory results, employ multiple orthogonal techniques and consider that apparent contradictions often reveal important regulatory mechanisms or conformational dynamics relevant to the protein's physiological function.

Remember that contradictions in experimental results frequently lead to deeper understanding of protein function and may ultimately provide critical insights into the biological role of yciC.

What approaches can be used to identify potential binding partners or substrates of yciC?

Identifying binding partners and substrates for a membrane protein like yciC requires multiple complementary approaches:

  • In vivo interaction identification:

    • Co-immunoprecipitation with antibodies against tagged yciC

    • Bacterial two-hybrid or split-protein complementation assays

    • Proximity labeling methods (BioID or APEX2 fusion proteins)

    • In vivo cross-linking followed by mass spectrometry

  • In vitro binding studies:

    • Pull-down assays with purified yciC and cellular extracts

    • Surface plasmon resonance (SPR) with potential interaction partners

    • Isothermal titration calorimetry (ITC) for quantitative binding parameters

    • Microscale thermophoresis for detecting interactions in solution

  • Substrate identification strategies:

    • Transport assays with reconstituted yciC testing candidate substrates

    • Metabolomic profiling comparing wild-type and yciC-knockout strains

    • Structural analysis and in silico docking to identify potential binding pockets

    • Thermal shift assays to detect stabilization by potential ligands

  • Bioinformatic approaches:

    • Genomic context analysis (genes frequently co-located with yciC)

    • Co-expression network analysis

    • Evolutionary coupling analysis to identify interaction interfaces

    • Structural homology to proteins with known binding partners

When designing these experiments, consider that yciC function may be influenced by the membrane environment and specific lipid compositions. Research on membrane protein insertases of the YidC/Oxa1/Alb3 protein family indicates that these proteins contain a hydrophilic groove that allows entry of newly synthesized membrane proteins into the lipid bilayer and guides their insertion and folding . If yciC has similar functions, experiments should be designed to account for potential interactions with both membrane lipids and other proteins.

What regulatory mechanisms likely control yciC expression in E. coli O127:H6?

The regulation of yciC expression in E. coli O127:H6 likely involves multiple regulatory mechanisms responding to environmental and physiological signals. While specific regulatory mechanisms for yciC are not directly described in the available literature, insights can be drawn from regulatory patterns observed in this bacterial strain:

  • Environmental signal response:
    Research on flagellar gene expression in E. coli O127:H6 demonstrates that environmental signals strongly influence gene expression . The transcription of flagella is activated in response to specific environmental and nutritional signals, suggesting that yciC might be regulated by similar mechanisms. Growth media composition dramatically affects gene expression in this strain, with flagellar genes being expressed in LB medium but repressed in DMEM .

  • Potential regulatory systems:

    • Stress response systems: The envelope stress response sigma factor σE (RpoE) often regulates membrane proteins

    • Two-component systems: EnvZ/OmpR or PhoP/PhoQ may respond to environmental signals and regulate yciC

    • Global regulators: H-NS, Fis, or Lrp might influence yciC expression based on growth phase

    • Nutrient-sensing systems: CRP-cAMP system may link carbon source availability to yciC expression

  • Experimental approaches to study regulation:

    • Promoter-reporter fusions to measure expression under different conditions

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the yciC promoter

    • RNA-seq comparing expression under various environmental conditions

    • Analysis of yciC expression in regulatory mutant backgrounds

Understanding the regulatory mechanisms controlling yciC expression is essential for interpreting its function in different environments and potentially manipulating its expression for experimental purposes.

How should experiments be designed to comply with NIH guidelines when working with recombinant yciC?

When designing experiments involving recombinant E. coli O127:H6 UPF0259 membrane protein yciC, researchers must adhere to NIH guidelines for research involving recombinant or synthetic nucleic acid molecules:

  • Applicable guidelines:
    The NIH Guidelines specify biosafety practices and containment principles for constructing and handling: (i) recombinant nucleic acid molecules, (ii) synthetic nucleic acid molecules, including those that are chemically or otherwise modified but can base pair with naturally occurring nucleic acid molecules, and (iii) cells, organisms, and viruses containing such molecules .

  • Institutional requirements:

    • All recombinant DNA work must be approved by the Institutional Biosafety Committee (IBC) before initiation

    • The research must be conducted at or sponsored by an institution that receives support for recombinant or synthetic nucleic acid research from NIH

    • If conducted abroad, research must comply with host country rules or be approved by an NIH-approved IBC

  • Experimental design considerations:

    • Appropriate biosafety level selection based on risk assessment

    • Proper containment measures for working with E. coli O127:H6, considering its enteropathogenic nature

    • Documented standard operating procedures for all recombinant DNA work

    • Proper decontamination and waste disposal protocols

  • Documentation requirements:

    • Detailed experimental protocols submitted to the IBC

    • Risk assessment documentation

    • Records of personnel training

    • Incident reporting procedures

It's important to note that E. coli O127:H6 is an enteropathogenic strain, and appropriate biosafety measures should be implemented when working with this organism, particularly when modified to express recombinant proteins that might affect its biological properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.